(data stored in ACNUC7421 zone)

EMBL: CP001053.PE388

CP001053.PE388       Location/Qualifiers
FT   CDS_pept        445245..445583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18763"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF92"
FT                   /protein_id="ACD18763.1"
FT                   /translation="MKSIISLALASAVFVTSAVQAQGLTRAEVKQQLIEAQANGLRYVT
FT                   ESSYPDVHPSFAHKVKAKAATPSAQSDEGGVPAGSHESGSAPHGLPMPEGNPHCVGPVS
FT                   FCNIYAGS"
     atgaaatcga tcatcagtct tgccctggct tcggccgtat ttgttacttc tgctgttcag        60
     gctcaaggct tgactcgtgc cgaggtgaag cagcaactca tcgaagcaca ggccaatggc       120
     ttgcgctacg ttactgagtc atcttatccc gatgtgcatc cgagtttcgc ccacaaggtg       180
     aaggccaaag ccgcgacacc atcggcgcag agcgacgaag gcggcgtgcc ggcaggatcg       240
     catgaatccg gcagcgcgcc gcacggactg ccgatgcctg agggcaatcc gcactgcgtt       300
     gggccggtga gcttctgcaa catctatgca ggttcgtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page