(data stored in ACNUC7421 zone)

EMBL: CP001053.PE39

CP001053.PE39        Location/Qualifiers
FT   CDS_pept        complement(43885..44202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18414"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE93"
FT                   /protein_id="ACD18414.1"
FT                   /translation="MKSLIQAVVIAAVLAAPVASFAQSNQPVTRAQVRAELIQLEKAGY
FT                   QPGLADPYYPADIQAAQARVARENGTAQAAESGYGGTVSGASQAGRPVPANGPQSVYFG
FT                   H"
     atgaaatcgc tcattcaagc tgttgttatc gctgctgtgc tggccgctcc tgttgcttcg        60
     tttgcgcagt ccaaccagcc cgtgacccgc gcccaagtgc gcgccgaact gattcaactc       120
     gaaaaagcag gctatcaacc cggcctcgcc gatccgtact acccagctga cattcaggcc       180
     gcacaagctc gcgtcgctcg tgaaaacggc accgcacagg cagcggaaag tggttacggt       240
     ggcacggtga gcggcgcttc tcaagcaggc cgcccggttc ctgcgaatgg tccgcagtcg       300
     gtttatttcg gtcactaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page