(data stored in ACNUC7421 zone)

EMBL: CP001053.PE391

CP001053.PE391       Location/Qualifiers
FT   CDS_pept        448782..450215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4390"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bxe:Bxe_B0709 heavy metal sensor signal
FT                   transduction histidine kinases (STHK); TIGRFAM: heavy metal
FT                   sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4390"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18766"
FT                   /db_xref="GOA:B2TF95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF95"
FT                   /protein_id="ACD18766.1"
FT                   /translation="MVPRTLRARLTALIIVSTSAILALSGLALYHVLRSCLESSSVEQM
FT                   SSTMAALHTHLSGIPTVHAIGGNAETVIDHLRGHPHMALAIYDTAGQRRLSTAGFKPYA
FT                   PIAAIVLNGAPLALTRAGSNLRYLLQRVALNGGIGPPVLVAIQYDGTGDEALLRVYACT
FT                   TVAIEVLGVLLAAVFAYGIALVGLLPLRRLVARAEAMSTSGLAQPLPELHASGELKELE
FT                   QAFNGMLTRLDESFTRLSQFSSNLAHDMRTPLTNLLAAAQVALSQRRSAEDYRDVIESS
FT                   VDEYRRLSHMIEDMLFLARSDQADAPPSLRLLDAVAEAERVAGYYETVAEDAQVEIKVT
FT                   GEGTVLADLLLFQRALSNLLSNALAQGPPGTTIIIDCKEEPDWTTLSVSDSGAGIEARH
FT                   LERIFERFYRVDPSRHGSASGTGLGLAIVKSIMTSHGGQCGCESRPHVRTCFWLRFPNH
FT                   DCSSHGMAARPGRDAVRKA"
     atggtgccgc gtacgctgcg tgcaaggctc actgctctca tcatcgtgtc tacgtcggcg        60
     atcctcgcgc tcagcgggct tgcgctatat cacgtgctgc gcagttgcct cgagtcgagc       120
     tcggtcgagc agatgtccag cacgatggcg gcgttacaca cgcatctgtc ggggattccg       180
     accgtgcatg ccattggcgg caacgcggag acggtgatcg accacctgcg tgggcatccc       240
     cacatggcgc ttgccattta cgacacagcg ggccagcgcc gcttgagcac ggcgggcttc       300
     aagccctatg cgccgattgc ggcaatcgtg ctgaacggtg cgcctttggc gctcacgcgc       360
     gccggttcga atcttcgata cctgctgcag cgcgtggcgc tcaatggcgg aatcggaccg       420
     ccggtgctgg tcgccattca atacgacggc accggcgatg aagcgctatt gcgcgtgtac       480
     gcctgcacca cggtggcgat cgaagtattg ggtgtgctgt tagccgccgt gttcgcatac       540
     ggtatcgccc tggtgggact gctcccgctg cgcaggctgg tggcccgggc agaagcgatg       600
     tcgacgagcg gtctcgcgca accgctgccg gaattgcatg cgtcaggcga gttgaaggaa       660
     ctggagcagg cctttaacgg catgctcacg cggcttgacg aatcgttcac ccggctaagt       720
     caattctcat ccaatcttgc gcacgatatg cgcacgccgc tcactaatct gcttgccgct       780
     gctcaggtgg cgttgtcaca gcgccgcagc gcggaggact accgggacgt tatcgagtcc       840
     agtgtggacg agtatcggcg gctgtcgcac atgatcgaag acatgctgtt cctggcgcgt       900
     tccgatcagg ctgatgcgcc cccgtccttg cgtttacttg acgcggtcgc ggaggccgag       960
     cgggtcgcgg gctactacga gaccgtggcc gaagatgcgc aggtcgagat caaggtgacg      1020
     ggcgagggca cggtgctagc cgatctgctg ctctttcaac gcgcgctcag caacctgctc      1080
     tcgaacgcgc tcgcgcaggg gccgccagga accaccatta tcatcgactg caaggaggag      1140
     ccggactgga ccacgctgag tgtgtcggat tcgggcgcgg gaatcgaagc tcgccatctc      1200
     gaacgcatat tcgagcggtt ctatcgtgtg gatccttcgc ggcacggttc ggcatcgggc      1260
     acggggctgg gcctcgccat cgtgaaatcg atcatgacga gccacggggg gcagtgcggc      1320
     tgcgaaagcc ggccacatgt gcgcacctgt ttctggctgc gctttccgaa ccatgattgc      1380
     tcaagtcacg gcatggcggc gcgcccagga cgcgacgccg tacgcaaagc gtga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page