(data stored in ACNUC7421 zone)

EMBL: CP001053.PE395

CP001053.PE395       Location/Qualifiers
FT   CDS_pept        complement(451943..452272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4394"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bxe:Bxe_B0714
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18770"
FT                   /db_xref="GOA:B2TF99"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF99"
FT                   /protein_id="ACD18770.1"
FT                   /translation="MRTYNHPAAEDFALGRLFHALSDPVRLEIVRRLASVDEATCGELD
FT                   GGRPKSSVSHHFRILREAGLVRTRVAGTVHQNSLRRAELDARFPGLMEAILKQIVAETA
FT                   ESEPA"
     atgcgcacct ataaccaccc cgccgccgag gatttcgccc tcgggcggct ctttcatgcc        60
     ctgagcgacc cggtccgcct cgagatcgtg cggcgcctcg cgtcggtcga cgaggccacc       120
     tgcggcgagc tcgacggtgg ccgccccaag tcgagtgtgt cccatcactt ccggatcctg       180
     cgcgaggcgg gtctcgtgcg cacgcgcgtg gccggcaccg tgcatcagaa ttcgctgcgg       240
     cgcgctgagt tggacgcccg ctttccgggc ttgatggagg cgattctcaa gcagatcgtc       300
     gcggaaacgg cggagagcga gccggcttga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page