(data stored in ACNUC7421 zone)

EMBL: CP001053.PE397

CP001053.PE397       Location/Qualifiers
FT   CDS_pept        454309..455337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4396"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bvi:Bcep1808_5897 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18772"
FT                   /db_xref="GOA:B2TFA1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA1"
FT                   /protein_id="ACD18772.1"
FT                   /translation="MTSSDEQRPAQQGYRSGEAARLAKMPVTTLRIWERRYGVVGPAKT
FT                   ASGQRLYTEDDVRRLTLIKLLVSRGHAIGAIARLDREQLQFLAARSGRESGGATDLPLV
FT                   ESVNLRLALVGGSLAQRFRASGVDLRPYGVNELITFADLSLAAAGGGTSGERGAPIDAL
FT                   LVSIDSLQEDIASQIIALGDAVRAKAIAVVYGFGTGPAAEILRVAGVRLYREPDSRTEF
FT                   RQMLGDLCERVRSQERIGDDAVWSRVRRRYDDRELEMIAGRSSTIACECPRHLAELVMK
FT                   LSAFERYSDACTSRSAQDAALHRYLGDVSNRACAMVEAALERVAREEGWFAGSQSPQAG
FT                   QA"
     atgacttcgt ctgacgagca acgaccggct caacagggct acagaagcgg tgaggcagcg        60
     cgcctcgcca agatgccggt cacgaccttg cggatctggg agcgccgtta cggcgtggtc       120
     gggccggcta aaaccgcgtc aggccagcgt ctctacacag aagacgacgt caggcgactc       180
     accttgatca aactgctggt gagccgcggc cacgcgatcg gcgcgatcgc acggctcgat       240
     cgcgagcaat tgcaatttct ggctgcgcgc agcggacgcg agagcggcgg cgcgactgac       300
     ctccctctgg tcgagtccgt caatctccgg ctcgctctcg tgggcggcag ccttgcgcag       360
     cgttttcggg cgtcgggtgt cgatttgcgg ccctatggcg tgaacgagct gatcacgttt       420
     gccgatctct ccctcgccgc ggcaggcggc ggcacgagcg gagagcgcgg cgcgccgatc       480
     gacgccttgc tggtcagcat cgactcactt caagaagaca tcgcgtcaca gatcattgcg       540
     ctcggcgacg cggttcgcgc gaaagccatc gcggtcgtct acggcttcgg caccgggccg       600
     gcggcggaga ttctgcgcgt ggcgggcgtg cgtctttatc gcgagcccga cagccggaca       660
     gaattccgtc agatgctcgg cgacctgtgc gaacgcgtgc gcagtcagga acgcatcggc       720
     gacgacgccg tgtggtcgcg cgtgcgccgt cgctacgacg accgcgagct ggaaatgatt       780
     gccggccgtt cttcgacgat tgcgtgcgag tgtccgcgtc acctcgcgga actggtcatg       840
     aagctctcgg cgttcgagcg ctacagcgac gcttgcacgt cgcgctcggc gcaggacgcc       900
     gcgctgcacc gctatctggg cgacgtcagc aaccgggcct gcgcgatggt cgaggcggcg       960
     ctcgaacgtg tcgcgcgcga agaaggctgg tttgccggat cgcagtcgcc gcaggccggt      1020
     caggcatag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page