(data stored in ACNUC7421 zone)

EMBL: CP001053.PE398

CP001053.PE398       Location/Qualifiers
FT   CDS_pept        455365..455988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4397"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_B0889 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4397"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18773"
FT                   /db_xref="GOA:B2TFA2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA2"
FT                   /protein_id="ACD18773.1"
FT                   /translation="MSHDASTDATIGASALDQKSAYLAALLERVSRREAGAFEALYRAS
FT                   APSLFGLAVRVTRTSESAEEVVQDGFIKIWRFAGSYDPGKASPSTWMSTIVKNQALDYL
FT                   RRNPYSGVYVDELDERNAAGDADVNFWQEFALDAERLSSYLGRLAPVQRQAIALAYFRG
FT                   QSQSEIAHTLDAPVGTVKSWISRGLESLRAMADARPAPHHGGLY"
     atgtcacatg atgcttcgac cgacgcgacc atcggcgcgt ccgcactgga tcagaagagc        60
     gcgtatctcg cggcgctgct cgagcgcgtt tcaaggcgcg aagccggcgc gttcgaggcg       120
     ctgtaccggg cgtcggcgcc gtcgctattc ggtctcgcgg tgcgcgtcac ccgcaccagc       180
     gaatcggccg aagaagtggt gcaggacggc ttcatcaaga tctggcgctt cgccgggtcg       240
     tacgaccccg gcaaggcttc gccgtccacg tggatgtcga ccatcgtgaa gaatcaggcg       300
     ctcgattatt tgcggcgcaa tccgtattcc ggcgtgtatg tcgacgaact ggacgagcgc       360
     aatgccgcgg gcgacgccga cgtgaatttc tggcaggagt tcgcgctgga tgccgagcgt       420
     ctgtcctcct atctcggccg cctggctccg gttcagcgtc aggcgatcgc gcttgcctat       480
     ttccggggtc aatcgcaatc ggagatcgcg catactctcg atgcaccggt cggcacagtg       540
     aaaagctgga tcagccgcgg actggagtcg ctgcgcgcga tggccgatgc gcgacctgcg       600
     ccgcatcacg gcggccttta ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page