(data stored in ACNUC7421 zone)

EMBL: CP001053.PE399

CP001053.PE399       Location/Qualifiers
FT   CDS_pept        456173..456850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4398"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: bxe:Bxe_B0716 putative pyrimidine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4398"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18774"
FT                   /db_xref="GOA:B2TFA3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA3"
FT                   /protein_id="ACD18774.1"
FT                   /translation="MNPYIVAHMMSSLDGRSLTDGWHLDYASDLYEDTAATFEADGWIC
FT                   GRVTMQEIAHGADYPKGLAKGAVPRTDHFVERKADQYAISIDPQGRVAWKSNTALKSHV
FT                   IEVLTEQVADDYLAYLQSIGVSYVFGGKTELDLGKVVQTLARELGVKKLIVEGGSHVSG
FT                   AFVNAGLVDEVSVLILPLVDGRSEHPSSFEVAMEKWQAPAYLKLTSVEQKEHGAVWLRY
FT                   TKA"
     atgaacccat atatcgtcgc tcacatgatg tcctcgctcg atggccgcag tctgacggac        60
     ggctggcatc tcgactatgc ctcggatctg tacgaagaca cggcagccac tttcgaagcc       120
     gacggctgga tctgcggacg cgtcaccatg caggaaattg cgcacggcgc ggattatccg       180
     aaaggactcg ccaagggcgc cgtgccgcgc accgatcact tcgtcgaacg caaagcggat       240
     cagtacgcga tttccatcga tccgcagggg cgagtggcgt ggaagagcaa caccgcgctc       300
     aagtcgcacg tgatcgaagt gctgaccgaa caggttgccg acgactacct cgcttatctg       360
     caatcgatcg gcgtgtcata cgtgttcggc ggcaagaccg aactcgatct cggcaaggtc       420
     gtgcaaacac tcgcgcgtga actcggtgtg aagaagctga tcgtggaggg cggttcgcat       480
     gtgagcggcg cgttcgtgaa cgcgggtctc gtcgacgaag tcagcgtgct gattttgccg       540
     ctggtggatg gccgcagcga acatccttcc tcgttcgaag tggccatgga gaagtggcaa       600
     gcgcccgcgt atctgaagct cacgtccgtc gaacaaaagg aacacggtgc agtgtggctg       660
     cgttatacga aggcctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page