(data stored in ACNUC7421 zone)

EMBL: CP001053.PE400

CP001053.PE400       Location/Qualifiers
FT   CDS_pept        complement(456949..457719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4399"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18775"
FT                   /db_xref="InterPro:IPR025522"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA4"
FT                   /protein_id="ACD18775.1"
FT                   /translation="MLPTSMKSLRKNAARLACVTMVFCSALLTGCAGSSIKDASAASTP
FT                   VQVRPDNIYVYTFDANPDQVKLDGGMMQKVKTQLEGSSAAQKQAADAAEVREQVANEIA
FT                   HQLQSMGLRAIRSDITAPADQNVLLVQGSFNTIDSGNRRRRMLIGLGAGKSQVSSSVQI
FT                   LYKPAGGTPRLVQTFTANADSGKAPGMVETAGVGAAAGSIATSAAVGGGLHAVSETKRA
FT                   GVSADAKRLADAVAKQIGEIGVNGGWLSTQHIKG"
     atgttgccta cttcaatgaa atccctcaga aaaaatgccg cccgtctggc ctgcgtgacg        60
     atggtctttt gcagtgcgct gctgaccggt tgcgccggca gcagcatcaa ggatgcgagc       120
     gcggcgagca cgccggtcca ggtgcgcccg gacaacattt atgtctacac cttcgacgcc       180
     aatccggacc aggtcaaact cgacggcggc atgatgcaga aagtgaagac gcagctcgaa       240
     ggttcgtccg cagcgcaaaa gcaggccgcc gatgccgccg aagtccgcga gcaggtcgcc       300
     aacgaaatcg cgcatcaatt gcagtcgatg ggtctgcgcg cgatccgctc ggatatcacc       360
     gcacccgccg atcagaatgt gctgctcgtg caaggcagct tcaacacgat cgactcgggc       420
     aatcgccgtc gccgtatgtt gatcggcctc ggtgcgggca agagccaggt gagcagttcg       480
     gtgcagattc tgtataagcc cgcgggcggc acgccgcgtc tggtgcaaac cttcaccgcc       540
     aacgctgaca gcggcaaggc gccgggcatg gtcgagacag cgggcgtggg cgcggcggcc       600
     ggcagtatcg cgacatcggc cgcagtgggt ggcggtctgc acgcggtatc cgaaaccaaa       660
     cgcgctggag tgtcagcgga cgcaaagcgc cttgcagatg cagtggccaa gcagattggc       720
     gagatcggtg tgaatggcgg atggctctcg acgcaacaca tcaaaggttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page