(data stored in ACNUC7421 zone)

EMBL: CP001053.PE405

CP001053.PE405       Location/Qualifiers
FT   CDS_pept        complement(462135..463976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4404"
FT                   /product="putative adhesin processing HmwC-like protein"
FT                   /note="KEGG: bxe:Bxe_B0723 putative adhesin processing
FT                   HmwC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4404"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18780"
FT                   /db_xref="InterPro:IPR040542"
FT                   /db_xref="InterPro:IPR041109"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFA9"
FT                   /protein_id="ACD18780.1"
FT                   /translation="MSTEFSLDRFESQIQSRDYDAAHEEFCTLLRTLSDKRGRLGAEHF
FT                   ARSTPNAPSDEKSRDTLQRIADGFTTLFSAPEYPLQAEKMNIMFWGRPWINMIFAVTSY
FT                   GSTDHIVRKLLETAEDNDEARAILTRKQLVLYTAGSQYDIDFTDLHRRDPVLATSLGVS
FT                   MVSAAVHISPAAHEKRERLLEWLPGALDKIEDLDELPTAAVCGAYMHCSYSTSPERHEI
FT                   KRSINRLVRKKLDALGLLGHEASVARTGIKGRKPVMLVVLEWFSGGHSIYRTHSRTMLA
FT                   ARQHFEVVAFGEAQNVDEAGRAIFDRFVEFEHPEYVGDCIRQIQAFAAREQPDVLYMPS
FT                   VGMFSHTIFLSNLRVAPLQIAGLGHPATMHAAHMDYVSVEDDFVGDPACFSEKMLRLPK
FT                   DGQPYVPSKLLTNVVPSVPERGDVVNIGVTASAMKINPHFLETCQAIVRTARVPVKFHF
FT                   MTCWNESIDLAYVRKSIYATLPESSVDVYGSLSYPEYLKILNTMDMFVSPFPFGNTNGI
FT                   VDSFTMGLPGVNLCGREVFEHIDSGLFERAGLPSWLTTYSTDEYVRAAARLAEQHDERE
FT                   ALRRRLIDGKAVERIFEGRPEAFGEGVLKLLNGLGEK"
     atgagcaccg aattttccct cgatcgtttc gaatcccaaa tccagtcccg tgactacgat        60
     gccgcgcacg aggaattctg cacgctactc aggacgctgt ccgacaagcg cggcaggctc       120
     ggcgccgaac acttcgcccg cagcacgccg aacgcaccca gtgacgaaaa atcgcgggac       180
     accttgcagc gcatcgccga cggtttcacc acgctgtttt ccgcccccga gtatccgctc       240
     caggcggaga agatgaacat catgttctgg gggcgcccgt ggatcaacat gatcttcgcc       300
     gtgacatcgt atggatcgac ggatcacatc gtccgcaagc tgctcgaaac cgcggaggat       360
     aacgatgaag cgcgcgccat cttgacccgc aagcaactcg tgctctacac cgcaggctcg       420
     caatacgaca tcgatttcac cgacctccac cggcgcgacc cggtgctcgc gacgagcctt       480
     ggcgtttcga tggtcagcgc ggccgtgcac atctcgccgg ccgcgcacga aaaacgcgaa       540
     cgtctgctcg aatggctgcc gggcgcgctc gacaagatcg aggacctcga cgagttgccg       600
     accgccgccg tctgcggcgc ctacatgcat tgcagctatt cgacatcgcc tgagcggcat       660
     gagatcaagc gcagcatcaa caggctggtg cgcaagaagc tggacgcgct cggcctgctc       720
     ggccacgagg ccagcgtcgc ccgcacagga atcaaaggac gcaagccggt gatgctcgtg       780
     gtgctcgaat ggttctcggg cggtcactcg atctatcgga cccattcgcg caccatgctc       840
     gccgcgcgcc agcattttga agtggtcgcg ttcggcgagg cgcagaacgt ggacgaagcg       900
     ggacgcgcga ttttcgatcg cttcgtcgaa ttcgagcatc cggaatatgt cggcgactgc       960
     atccgccaga tccaggcgtt cgccgcacgc gagcaaccgg acgtgctcta tatgccgagc      1020
     gtcggcatgt tctcgcacac gatctttctg tcgaacctgc gcgtcgcgcc gttgcagatc      1080
     gcaggcctcg gtcatcccgc gacgatgcac gcggcgcata tggactacgt gagcgtggag      1140
     gacgatttcg tcggcgatcc ggcctgcttc agcgaaaaaa tgctgcgtct gccgaaggac      1200
     ggccaaccgt acgtgccgtc gaaactgctc accaatgtcg tgccgtccgt gccggagcgc      1260
     ggcgacgtgg tcaacatcgg cgtgacggcc agcgcgatga aaatcaatcc gcactttctc      1320
     gagacctgcc aggcgatcgt tcgcactgcg cgcgtgccgg tcaaattcca tttcatgaca      1380
     tgctggaacg aaagcatcga tctggcgtac gtcagaaagt cgatctacgc gacgctgccg      1440
     gaatcgagcg tggacgtgta cggctcgctc agctaccccg agtatctgaa gatcctcaac      1500
     acgatggaca tgttcgtgag cccgttccca ttcggcaata ccaacggcat cgtcgattcg      1560
     ttcacgatgg gcctgcccgg cgtcaacctg tgcggacgtg aagtgttcga gcatatcgac      1620
     agcggccttt tcgagcgcgc tggcctgccg tcatggctca caacctattc gaccgacgaa      1680
     tacgtgcgcg ccgccgcccg gctcgccgaa cagcacgacg agcgcgaagc gctgcgccgg      1740
     cgcctgatcg acgggaaagc ggtcgagcgg atcttcgagg gccgtcccga agcgttcggc      1800
     gaaggcgtat tgaagttgct gaacggtctc ggcgaaaagt aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page