(data stored in ACNUC7421 zone)

EMBL: CP001053.PE409

CP001053.PE409       Location/Qualifiers
FT   CDS_pept        472018..472908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4408"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bxe:Bxe_B0727
FT                   transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18784"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB3"
FT                   /protein_id="ACD18784.1"
FT                   /translation="MKHTPTVLSVSHRTTYRYSTFVETAQHLATIRPIACSWQRVVSHS
FT                   EKIEPEPSYMNSRIDAFGNDVLYFALDAPHERLQLVSETTVALMPRWTDLDPEATPAWD
FT                   DVADALRFRVGGRFRPEAEFCFASPNIVPRPSLRDYALPSFPPGMPVAAGAIDLMHRIH
FT                   EDFAYKPSATMFDTPAERAFELKSGVCQDFAQVMIGCLRSLGLPARYVSGYLRNDPPPG
FT                   QPRLIGADASHAWVSVYCPGSGWIDLDPTNDVLADMDHVTLAIGRDYSDVSLLRGMILG
FT                   GGAHRVEVGVTVLAL"
     atgaagcaca cgccgaccgt gctgtccgtc tcgcatcgca ccacttatcg ctactccacc        60
     tttgtggaga ccgcgcagca tctcgcgacg atccggccga ttgcctgttc atggcagcgc       120
     gtggtctcgc acagcgaaaa gatcgaaccc gaaccgtcgt atatgaatag ccggatcgac       180
     gcattcggca acgacgtgct gtatttcgcg ctggatgcgc cgcatgagcg cttgcaactt       240
     gtcagcgaaa ccacggtggc gctcatgccg cgctggaccg atctcgatcc cgaggcgacg       300
     cccgcatggg acgacgtggc cgacgcgctg cgctttcgcg tcggcggccg gttccggccc       360
     gaggcggagt tctgtttcgc gtcgccgaat atcgtgccac ggccgtcgtt gcgggactat       420
     gcgttgccga gttttccgcc cggcatgccg gtcgccgcgg gcgcgatcga tctgatgcac       480
     cgcattcacg aagacttcgc ctacaagcct tccgcgacga tgttcgatac gccggccgaa       540
     cgcgccttcg aattgaaaag cggcgtgtgt caggacttcg cgcaggtgat gatcggctgc       600
     ttgcgctcgc tgggtttgcc tgcgcgctac gtgagcggct atctgcgcaa cgatccgccg       660
     ccgggacagc cgcggttgat tggcgccgac gcgtcgcacg cgtgggtgtc cgtgtattgc       720
     cccggcagcg gctggatcga tctcgatccg accaacgacg tgctcgccga tatggatcac       780
     gtgacgctcg ccatcggccg cgattacagc gatgtctcgt tgctgcgcgg gatgattctg       840
     ggtggtgggg cgcatcgggt ggaagtgggg gtgacggtgc ttgcgctttg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page