(data stored in ACNUC7421 zone)

EMBL: CP001053.PE41

CP001053.PE41        Location/Qualifiers
FT   CDS_pept        complement(45122..45604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4030"
FT                   /product="protein of unknown function DUF847"
FT                   /note="PFAM: protein of unknown function DUF847; KEGG:
FT                   bxe:Bxe_B0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18416"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE95"
FT                   /protein_id="ACD18416.1"
FT                   /translation="MDNFEDAFRALIGSEGGYSFNPHDPGGETMWGVTARVARSAGYAG
FT                   AMKDLPLDTARQIAKQKYWDPLHLDELDPRVAFQIFDANYNGGLVVLWMQKASGAKEDG
FT                   KFGPDTLDAVKNADALKFVMRFAAYRLRYLRNLHAWPNFSRGWTERMAANLLLGAA"
     atggacaatt tcgaagatgc gttcagagct ctgattggca gtgaaggcgg ttactccttc        60
     aatccgcacg accctggcgg tgaaaccatg tggggagtca cggcgcgcgt ggcacgcagc       120
     gcgggctatg ccggcgccat gaaagacctg ccgctggata ccgccagaca gatcgccaaa       180
     cagaagtact gggacccgct gcatctggac gaactcgacc cgcgcgttgc cttccagatc       240
     tttgacgcca attacaacgg cggcctggtg gtgttgtgga tgcaaaaagc ttccggtgcg       300
     aaagaagacg gcaagttcgg cccggacaca ctcgatgcgg tgaaaaatgc ggacgcgctg       360
     aagtttgtca tgcgcttcgc cgcctatcgc ttgcgttacc tgcgcaacct gcacgcatgg       420
     cccaatttca gccgtggatg gaccgaaaga atggccgcta atcttctcct gggagcagca       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page