(data stored in ACNUC7421 zone)

EMBL: CP001053.PE410

CP001053.PE410       Location/Qualifiers
FT   CDS_pept        473096..473845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4409"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein ArsR; regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: bxe:Bxe_B2051
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18785"
FT                   /db_xref="GOA:B2TFB4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFB4"
FT                   /protein_id="ACD18785.1"
FT                   /translation="MNTEQGVTGAERVLLVLAALASHGKAMSVKELLAVTGLAQSTLYR
FT                   QIALLKRWGFVAENAGHYAPGPISLQLALGFDVNSLLVEASRSEMQRLARASQESIGLV
FT                   VAVKHQVMCLEMVDSQHSLRCSFEKGRAVALKAGASAKSLLAFMADKARTEVLDNLFND
FT                   DPAGRVAIEARLEQIRAQGYAVSDSEVDPGVWGVSAPIFHRSGRGAGSGASITLMAPST
FT                   RAVGRESQFIDGTLRTARAISERMQTD"
     gtgaatacgg aacaaggtgt gacaggtgct gaacgggtgc tgctcgtgct ggcggcgctc        60
     gccagtcacg gtaaggccat gtcggtgaaa gagctgctgg ctgtcaccgg actcgcgcaa       120
     agcaccttgt accggcagat cgccttgctc aagcgctggg gcttcgtcgc ggagaacgcg       180
     gggcattacg cgccgggccc cattagcctg cagttggcgc tgggcttcga cgtcaattcg       240
     ctgctggtcg aagcgagccg cagcgagatg cagcggctcg cgcgagcatc gcaggaaagc       300
     attggactgg tggtcgccgt taaacatcag gtgatgtgtc tggagatggt cgacagccag       360
     cactcgctgc gctgttcgtt cgagaaagga cgcgccgtgg cgctcaaggc gggtgcgtcg       420
     gcgaagtcgc tgctcgcgtt catggccgac aaggcacgca ccgaagtact cgacaacctg       480
     ttcaatgacg atccggccgg ccgcgtggca atcgaagccc ggttggagca gattcgcgcc       540
     caaggctacg cagtcagcga cagtgaagtg gatccgggtg tctggggtgt gagcgccccg       600
     atattccatc gcagcggacg cggcgccggc agcggcgcgt cgatcacgct gatggcgccg       660
     tccacgcgcg ccgtcggccg cgaaagccaa ttcatcgacg ggacgctacg tacggcccgc       720
     gccatttccg agcgtatgca aaccgattga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page