(data stored in ACNUC7421 zone)

EMBL: CP001053.PE419

CP001053.PE419       Location/Qualifiers
FT   CDS_pept        480973..482406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4418"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_B0738 MFS multidrug efflux pump,
FT                   outer membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4418"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18794"
FT                   /db_xref="GOA:B2TFC3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC3"
FT                   /protein_id="ACD18794.1"
FT                   /translation="MKPILVKVLASAALLTLAACAVQPETHADLPQTVKTVAPAAWNVD
FT                   APQDSVSANAWWDQFGDPVMHQLVESVLTGNLDVQAAVERVRQAQDLAKQNRAALLPEL
FT                   NASATASDSRQNTPPPLGYVRQAGVGLTASWTPDVFGGERLAVLAAQAQVSGRQSALNE
FT                   VRLALAANTAAAYIDLRWAQSQLQILSDNEQIRARALKLTQQRLHYGLSTQLDVARAQN
FT                   QLQDLQAQIPRVQSAVQHQLSLIAVYSGRTPESVDSLLLANARDIPVPAQSVPQMLPSE
FT                   ALLQRPDVRTAYATVEQRAAEVGVSKAQRYPQFRLNLADGLLASSYLGLPTLTDNLFSA
FT                   ALNATSPIFNAGRITANIDASESRMRESQLGLQQTMLQALKEIEDNRSDLVSGAVQVQR
FT                   LGGALDASNQALHLSSELYKGGAADFLDVLTAQEAYLRDAESLNQAKREHALSAVALYR
FT                   SLGGGWDVPDAVTAVSSSN"
     atgaaaccga tccttgtcaa agtcctggcg agcgccgcct tgctgacgct cgcggcgtgc        60
     gcggtgcaac cggaaacgca cgccgatttg ccgcaaaccg tgaagacggt cgcgcccgcc       120
     gcgtggaatg tcgacgcgcc gcaagacagc gtgagcgcca acgcgtggtg ggaccaattc       180
     ggcgacccgg tcatgcatca gctggtcgaa tccgtgttga ccggcaatct cgatgtgcag       240
     gcagcggtgg agcgcgtcag gcaggcgcag gatctggcga agcagaatcg cgcggcgctg       300
     ctgcctgagt tgaacgcgag cgcgacggcg tccgactcgc gtcagaacac gccgccgccg       360
     ctcggttatg tgcgccaggc cggcgtcggc ttgacggcga gctggacgcc cgatgtattc       420
     ggcggcgaac gtcttgccgt gctggcggcg caggcgcagg tgtcggggcg ccagtcggca       480
     ttgaacgagg tgcgcctcgc actcgcggcg aataccgccg cagcgtatat cgatctgcgc       540
     tgggcgcaat cgcagttgca gattctgagc gacaacgagc agatccgcgc acgcgctttg       600
     aagctcacgc agcagcggct gcactatggg ctgtcgacgc aactcgacgt cgcgcgcgcg       660
     cagaaccagc tccaggattt gcaggcgcag attccgcgcg tgcaatctgc ggtgcagcat       720
     caattgagtc tgatcgcggt gtattcgggg cgcacgccgg agagcgtcga cagcctgctg       780
     ctcgccaacg cacgcgatat tccggtgccc gcgcaaagcg tgccgcagat gctgccttcg       840
     gaggcgcttc tgcagcgtcc cgatgtgcgt accgcgtacg cgacggtcga gcagcgcgca       900
     gcggaagtgg gcgtgtcgaa agcgcagcgc tatccgcagt tccggctcaa tctcgccgac       960
     ggcctgctgg cctcgtcgta cctcggcttg ccgacgctga ccgacaacct cttcagcgcg      1020
     gctttgaacg cgacgagccc gatcttcaac gcgggccgca tcaccgcgaa tatcgacgcg      1080
     agcgaaagcc gcatgcgcga atcgcaactc ggtttgcagc aaaccatgct gcaagcgctg      1140
     aaggaaatcg aggacaaccg cagcgatctg gtgagcggcg cggtgcaggt gcaacgtctc      1200
     ggcggcgcgc tcgatgcgtc gaaccaggcg ctgcatttgt cgagcgaact gtacaagggc      1260
     ggcgcggcgg attttctcga tgtgctcacc gcacaggagg cgtatctgcg tgacgcggag      1320
     tccttgaacc aggccaagcg cgagcatgcg ctctcggcgg tcgcgttgta ccgctcgctc      1380
     ggcggcggct gggatgtgcc cgacgcggtc acggcggtgt cgtcgagcaa ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page