(data stored in ACNUC7421 zone)

EMBL: CP001053.PE424

CP001053.PE424       Location/Qualifiers
FT   CDS_pept        486725..487660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4423"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bxe:Bxe_B0743 ketopantoate reductase
FT                   ApbA/PanE; TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4423"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18799"
FT                   /db_xref="GOA:B2TFC8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC8"
FT                   /protein_id="ACD18799.1"
FT                   /translation="MRILVVGAGAVGGYFGGRLAAAGQDVTFLVRPGRAEKLKRDGLVI
FT                   SSVRGDLKLPDPQTILAGVSAEPFDLVLLSCKAFSLDDAIDSFAPLVGESTLILPMLNG
FT                   MRHMEVLNEKFGAARVLGGQCVIAATLNAEQHIVHLNDTHAITFGEQAGGASERVQAIA
FT                   EAMGDANFDAVISDNILLRMWEKWVFLATLAGGTCLMRGSVGDILAAPDGKRVIENLLG
FT                   ECRAVAEHNGFTMGPDFDARATQTLFTPSPLTASMLRDVENHSHTEADHILGDLISRGG
FT                   DAQKGEHGLSLLRIAYSHLKTYEARQARTS"
     atgcgaattc tagtagtagg ggcgggcgcc gtaggcggct atttcggcgg gcgtctcgca        60
     gcggcgggcc aggacgtgac cttcctcgtg cgtcccggcc gggcggaaaa gctcaagcgt       120
     gacgggcttg tcatcagcag cgtacgcggc gatctcaagc tgcccgatcc gcagacgatt       180
     ctcgccggcg tcagcgccga gcccttcgat ctcgtgctgc tgagctgcaa agccttcagt       240
     ctcgacgacg cgatcgattc cttcgcgccg ctcgtcggcg agtcgacgct gattctgccg       300
     atgctcaacg gcatgcgtca tatggaggtg ctcaacgaaa agttcggcgc cgcacgcgtg       360
     ctgggcgggc aatgcgtaat cgccgccacg ctcaatgccg agcagcatat cgtgcatctt       420
     aacgacaccc acgcgatcac gttcggcgaa caggccggcg gcgcgtcgga acgtgttcag       480
     gcaatcgccg aagccatggg cgatgcgaat ttcgacgccg tgatcagcga caacatcttg       540
     ctgcgcatgt gggagaagtg ggtgttcctg gccacattgg cgggcggcac gtgcttgatg       600
     cgcggttcgg tcggcgatat tctggctgcg ccggacggca agcgcgtgat cgagaacctg       660
     ctcggcgagt gccgcgcggt ggccgagcac aacggcttca ccatgggccc ggacttcgac       720
     gcacgcgcca cgcaaacgct cttcacgcct tcgccgctca ccgcgtccat gttgcgggat       780
     gtggaaaatc actcgcatac cgaggcggat catattctcg gcgatctgat ttcgcgcggc       840
     ggcgacgcgc aaaagggcga gcacggtttg tcgttgctgc gtatcgccta tagtcatctg       900
     aagacgtatg aagcgaggca ggcccgcacg tcctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page