(data stored in ACNUC7421 zone)

EMBL: CP001053.PE425

CP001053.PE425       Location/Qualifiers
FT   CDS_pept        487728..488027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4424"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18800"
FT                   /db_xref="GOA:B2TFC9"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFC9"
FT                   /protein_id="ACD18800.1"
FT                   /translation="MPTPIGSVPALSAASATIFSIGIVFLGYWGLYEPIQWRAADVFVF
FT                   VFALIGFGCLGLVPWVATSPVEPEGSDSRIRIARHLFLAGVAGIWLAVAMSVIF"
     atgccgactc ccatcggatc agtgcccgca ctcagtgccg cttcggccac gatcttctcg        60
     atcggcatcg tctttctcgg ctactggggt ttgtatgagc cgatacagtg gcgagccgcc       120
     gacgtcttcg tgttcgtgtt cgcgctgatc ggtttcggtt gcctcgggct cgtgccgtgg       180
     gtcgccacga gtcctgtcga acccgaaggc agcgatagcc ggattcgcat tgcgcggcat       240
     ctgtttcttg ccggcgtggc ggggatctgg cttgcggtgg cgatgtcggt gattttctag       300
//

If you have problems or comments...

PBIL Back to PBIL home page