(data stored in ACNUC7421 zone)

EMBL: CP001053.PE428

CP001053.PE428       Location/Qualifiers
FT   CDS_pept        complement(490313..491746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4427"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B0747 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4427"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18803"
FT                   /db_xref="GOA:B2TFD2"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD2"
FT                   /protein_id="ACD18803.1"
FT                   /translation="MSDERRIVIVGAGPAGVRAAETLVAAGVKPIVIDENARWGGQIYR
FT                   QPPANGGFERSKKTLYGFEAHKAEALHSTMAALLPHLDYRPDTLAWACEAGRLDTLHAG
FT                   RELRVPFSHLIIASGATDRVLPVPGWTLPGVYTLGAAQVALKAQGCAIGRRVVLAGTGP
FT                   LLYLVAYQYVKAGAQVVAVLDTSPFSQQIAAAPKLARLPGTFAKGLYYVGWLKTHGVRI
FT                   ERDVTLVGIRGVDGVQALEWRASREGSPTETIACDAVGVSFGLKPETQLADLAGCRFRF
FT                   DATNRCWLPEVDPAGRSSVRGLYLAGDGAGIAGADAAELAGRRAALALLDDLGIAHPRG
FT                   AGMPDAASIERSLKRIAVFREGIETAFAPPANCASQWPDDMTVCRCEEIDAGTLRRCIR
FT                   GGEANEINRLKALTRVGMGRCQGRMCGEAALTLLAEETGKPLDAVGRLRSQPPVKPIPL
FT                   APEMYADDLAEIPAEARDE"
     atgagcgacg aacgccgcat cgtgatcgtc ggcgccgggc cggcgggcgt acgcgccgcc        60
     gagacgctgg tcgcggccgg cgtgaagccg atcgtgatcg acgaaaacgc gcgctggggc       120
     ggccagatct atcggcaacc gccggcgaac ggcggcttcg agcgctcgaa aaaaacgctc       180
     tacggtttcg aagcgcacaa ggccgaagcc ttgcactcga ccatggccgc gcttctgcct       240
     catctcgact atcgtcccga cacgctcgcg tgggcctgcg aagccggtcg cctcgatacc       300
     ttgcacgcgg gacgcgaact gcgcgtgccg ttctcgcacc tgatcattgc cagcggcgcg       360
     actgaccgcg tgctgccggt gccgggctgg actctccccg gcgtctacac gctcggcgcg       420
     gcccaggtcg cgctgaaggc gcaaggctgc gcgatcggcc gacgcgtcgt gctggccggc       480
     accggaccgt tgttatatct cgtggcgtat cagtacgtga aagcgggcgc gcaggtcgtg       540
     gccgtactcg acacgagtcc gttctcacag cagatcgccg cggcgccgaa actcgcgcgt       600
     ctgccgggca cgttcgccaa aggtctgtac tacgtcggct ggctgaaaac gcatggcgtg       660
     cggatcgagc gcgatgtgac gctggtgggc attcgcggcg tggatggtgt gcaagcgctc       720
     gaatggcgcg cttcgcgtga aggctcgccg accgaaacca ttgcatgcga cgcggtcggc       780
     gtgagcttcg gcctgaaacc cgaaacgcag ctcgccgatc tcgcgggctg ccgcttccgt       840
     ttcgatgcga ccaaccggtg ctggctgcct gaagtcgacc cggcgggacg cagttccgtg       900
     cgcggtctct atcttgccgg cgacggcgcg ggcatcgccg gcgcggacgc cgccgaactg       960
     gccggccgcc gcgccgcgct cgctttgctc gacgacctcg gcatcgcgca tccgcgtggt      1020
     gcgggcatgc ccgacgcggc atcgatcgag cgtagtctga aacgtatcgc ggtgtttcgc      1080
     gagggcatcg aaacggcttt cgcgccaccg gccaactgcg cgtcgcaatg gcccgacgac      1140
     atgaccgtgt gccgctgcga agagatcgac gcgggtacct tgcgacgctg cattcgcggc      1200
     ggcgaagcga atgagatcaa ccggctgaag gcgctcacgc gcgtcggcat gggccgctgc      1260
     caggggcgca tgtgcggcga agccgcgctc actctcctcg ccgaggaaac cggcaagccg      1320
     ctcgacgcag tcggccgttt gcgcagccag ccgcccgtca aaccgattcc gctcgcgccg      1380
     gaaatgtatg ccgacgacct cgccgaaatt cccgcggagg cgcgcgatga gtaa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page