(data stored in ACNUC7421 zone)

EMBL: CP001053.PE437

CP001053.PE437       Location/Qualifiers
FT   CDS_pept        complement(499983..500897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4436"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0755 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4436"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18812"
FT                   /db_xref="GOA:B2TFD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD8"
FT                   /protein_id="ACD18812.1"
FT                   /translation="MPRSIQSTAAALDPLAAIARAPRSRGPLATAAWRFVRNRAAFAGF
FT                   VVLMLIVIACVAGPWLLPNNPIDSDWSAISLPPTLQNMHWFGTDELGRDLLARTLQGGR
FT                   VSLEVGLLGTLVSGLIGVAYGATAGYLGGRVDAVMMRIVDMMYAIPYMLIAILMMTMFG
FT                   RAFYLVVLTISAFSWLDMARVVRGQTLSLRSREFIDAARAIGVSSGSIIARHIVPNLFG
FT                   VVVVYASVTVPNIVLTESVLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVML
FT                   CVTLYCVNFVGDGLRDAFDPKDR"
     atgccccgct caattcaatc gactgccgcg gcgctcgatc cgctcgcggc catcgccagg        60
     gcgccgcgct cacgcggccc gctcgccacc gccgcgtggc gcttcgtgcg caaccgcgcc       120
     gcattcgcgg gcttcgtcgt gctgatgctg atcgtgatcg cgtgcgtggc gggtccgtgg       180
     ctgctgccga acaatcccat cgacagcgac tggagcgcga tcagcctgcc gccgacgctg       240
     caaaacatgc attggttcgg caccgacgaa ctcggccgcg atctgctcgc gcgcactttg       300
     caaggcgggc gcgtgtcgct cgaagtcggt ctgctcggca cgctggtgtc gggcctgatc       360
     ggggtcgcgt atggcgcgac agcgggctat ctcggcggac gcgtcgacgc ggtgatgatg       420
     cgcatcgtcg acatgatgta cgcgattccc tacatgctga tcgccatcct gatgatgacg       480
     atgttcggcc gcgctttcta tctggtcgtg cttactatca gcgcgttttc gtggctcgac       540
     atggcgcgcg tggtgcgcgg ccagacgctg tcgttgcgct cgcgcgaatt catcgacgcg       600
     gcgcgagcga tcggcgtgag ttcgggctcg atcatcgcgc gtcacatcgt gccgaatctg       660
     ttcggcgtgg tcgtggtgta cgcgagtgtg acggtgccga acatcgtgct gacggaatcg       720
     gtgctgtcgt ttctcggcct cggcgtgcag gagccgatga cgagttgggg cgtgctgatt       780
     caggacggcg cgcagaagct cgaatcgatg ccgtggctgc tgctgtgccc ggccgtgatg       840
     ctgtgcgtga cgctgtattg cgtgaatttc gtcggcgatg gtttgcgcga cgcattcgat       900
     ccgaaggacc gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page