(data stored in ACNUC7421 zone)

EMBL: CP001053.PE438

CP001053.PE438       Location/Qualifiers
FT   CDS_pept        complement(500901..501839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4437"
FT                   /product="Nickel-transporting ATPase"
FT                   /EC_number="3.6.3.24"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0756 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18813"
FT                   /db_xref="GOA:B2TFD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TFD9"
FT                   /protein_id="ACD18813.1"
FT                   /translation="MLAYTLRRTLWAIPTILAVITACYLLLHLTPGGPFDTEKQLSAAV
FT                   LANLNAKYHLDEPLWLQYLHYLGSLLHGDLGPSFRYADWSVNDLVWKALPVSLGVGGVS
FT                   VPIALVIGVALGTVAAVRRDRFVDHFVMVLGNLGNVVPPFVLGPVLVWIFAILLKTSEG
FT                   HGWLPAGGWGEGEWRYRVLPIVLLTIINVAAIARVMRGSMIEVLSGNFIRTARAKGLPG
FT                   RTIVLRHAMKPALMPVVSLLGSICISSITAAVVTESVFALPGLGQLVVNGAINRDYTLV
FT                   LGLVVLTTAVAVLFNLLVDLAYAWLDPRIRY"
     atgctggcct atacgctgcg ccgcacgctc tgggcgatcc cgacgattct cgccgtgatc        60
     accgcgtgct atctgctgct gcatctcacc ccgggtggcc cgttcgacac cgagaagcaa       120
     ctctcggccg ccgtgctcgc gaacctgaac gccaagtatc acctcgacga accgttgtgg       180
     ctgcagtacc tccactacct cggctcgctg ctgcacggcg acctcgggcc gtcgttccgc       240
     tacgccgact ggtcggtcaa cgatctggtg tggaaagcac tgccggtgag cctcggcgtg       300
     ggcggcgtgt cggtgccgat cgcgctcgta atcggcgtcg cgctcggcac ggtggccgcg       360
     gtgcggcgcg accgcttcgt cgatcacttc gtgatggtgc tcggcaatct cggcaacgtg       420
     gtgccgccct tcgtgctggg accggtgctg gtgtggatct tcgcgatcct gctgaaaacg       480
     tccgaagggc acggctggct gccggccggc ggctggggcg aaggcgaatg gcgctatcgc       540
     gtgctgccga tcgtgctgct caccatcatc aacgtcgcag cgattgcgcg tgtgatgcgc       600
     ggcagcatga tcgaagtgct gtcgggcaac ttcatccgca ccgcacgcgc caagggtttg       660
     ccgggccgca cgatcgtgtt gcgtcacgcg atgaagccgg cgctgatgcc ggtcgtctcg       720
     ctgcttggct cgatctgcat ctcgtcgatc accgcggcgg tggtcaccga atcggtgttc       780
     gcgctgccgg gcctcggcca actggtcgtc aacggtgcaa tcaatcgcga ctacaccctc       840
     gtgctcggcc tcgtcgtgct gacgaccgcg gtcgccgtgc tcttcaatct gctggtcgac       900
     ctcgcgtatg cgtggctcga tccgcgcatc cggtactga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page