(data stored in ACNUC7421 zone)

EMBL: CP001053.PE441

CP001053.PE441       Location/Qualifiers
FT   CDS_pept        505151..506692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4440"
FT                   /product="amino acid/peptide transporter"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: bxe:Bxe_B0759 major facilitator superfamily
FT                   (MFS) peptide/H+symporter, POT family; TIGRFAM: amino
FT                   acid/peptide transporter; PFAM: TGF-beta receptor type I/II
FT                   extracellular region; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4440"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18816"
FT                   /db_xref="GOA:B2TE24"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE24"
FT                   /protein_id="ACD18816.1"
FT                   /translation="MNSTTPAGARVSQTRSFSTVFLIEMWERFGYYGMAALLVLFMIDK
FT                   LQFTDSHATLTWGAFTALVYASPSIGGWIGDKILGARRTMIFGAGVLSVGYFMLALPND
FT                   QLAYMYASLGVIVVGNGLFKANAANLVRRIYEGDDARIDSAFTIYYMAVNIGSTVSMLA
FT                   TPWIKDHWGWHTAFAVCCAGMLLSMLNYFIMFRTLAHIGSAPDAEPVRWKRVGAVALGG
FT                   LALGAATMFVLQHKAIAVACVYTAGVAILAIFGYMLMKCERSERSGLVAALILTAQVIL
FT                   FFVFYVQMSTSLTLFALRNVDPRFILFGQTWFTWSAAQFQALNPIWIMLLSPLLALLYT
FT                   KLAKSGKDVPVAVKYAFGFAVVAAGFFVYAASGNYAVNGRVSSWFMVGGYGLYSLGELL
FT                   VSGLGLAMIARYVPARMSGFMMGAYFVATGVSQYLGSVVANFAQMPAGDMDPLESLPLY
FT                   TKLFTGLGWLAAVGALVAVLLLPLMRKLSREHQRCSDEARESARQTAALNGAVAE"
     atgaattcaa ccactccggc gggcgcacgc gtctcgcaga cccgttcgtt ttcgacggtc        60
     tttctgatcg agatgtggga gcgcttcggc tattacggca tggccgcgct gctcgtgctg       120
     ttcatgatcg acaagctgca gttcaccgac agccacgcca cgctcacgtg gggcgcattc       180
     acggcgctgg tgtacgcgtc gccgtcgatc ggcggctgga tcggcgacaa gattctcggc       240
     gcgcggcgca cgatgatctt cggcgccggc gtgctgtccg tcggctattt catgctggcg       300
     ctgcccaacg accagcttgc ctatatgtat gcgtcgctcg gcgtgatcgt ggtcggcaac       360
     ggcctcttca aggccaacgc cgcgaatctc gtgcgacgca tttatgaagg cgacgacgcg       420
     cgtatcgaca gcgcattcac gatctactac atggcggtca acatcggctc gacggtgtcg       480
     atgctcgcca cgccgtggat caaggaccat tggggctggc atacggcctt cgccgtgtgc       540
     tgcgcgggga tgctgttgtc gatgctgaac tacttcatca tgttccgtac gctcgcgcat       600
     atcggctccg cgccggacgc cgaaccggtg cgctggaagc gcgtcggcgc ggtggcgctg       660
     ggcggcctcg cgctcggcgc ggcgaccatg ttcgtgctgc agcacaaggc gatcgcggtg       720
     gcctgcgtgt acacggcggg cgtcgcgatt ctcgcgatct tcggctacat gctgatgaag       780
     tgcgaacgct cggagcgttc tgggctcgtc gccgcgctga tcctgaccgc gcaggtgatc       840
     ctctttttcg tgttctatgt gcagatgtcg acgtcgctca cgctgttcgc gttgcgcaac       900
     gtcgatccgc gtttcattct gttcggccag acgtggttca cgtggagcgc cgcgcaattc       960
     caggcactca acccgatctg gatcatgttg ctgagtccac tgctcgcgct gctgtacacg      1020
     aagctcgcga agagcggcaa ggacgtgccg gtggcggtca agtatgcgtt cggcttcgcg      1080
     gtggtggcgg ccggcttctt cgtctatgcg gcgagcggca actatgcggt gaacggacgc      1140
     gtgtcgtcgt ggttcatggt gggcggctac ggtctgtatt cgctcggcga attgctggtg      1200
     agcgggctgg ggctcgcgat gatcgcgcgc tacgtgccgg cgcgcatgag cggtttcatg      1260
     atgggcgctt acttcgtggc gaccggcgtg tcgcaatatc tgggcagcgt ggtggcgaat      1320
     ttcgcgcaga tgccggcggg cgatatggat ccgctggaat cgttgccgct gtataccaag      1380
     ctgtttacgg gcctcggctg gctcgcggcg gtgggcgcgc tggtggcggt tctgttgctg      1440
     ccgttgatgc gcaagctctc gcgtgaacat cagcgttgca gcgacgaggc gcgtgagagc      1500
     gcgcggcaaa cggcggcgtt gaatggggcg gtggcggagt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page