(data stored in ACNUC7421 zone)

EMBL: CP001053.PE443

CP001053.PE443       Location/Qualifiers
FT   CDS_pept        508898..509350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4442"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bxe:Bxe_B0762 Bph2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4442"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18818"
FT                   /db_xref="GOA:B2TE26"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE26"
FT                   /protein_id="ACD18818.1"
FT                   /translation="MPTSAKKVAKKAAAPVPAKKVAAKKVPAKKAVAAKKVAVKASSAP
FT                   APIKDTFTKASLAAHVAERAAVEPKTAKAVLAALEDTILGAVHKKGAGEFTLSGLLKIV
FT                   VQAVPAKKKRFGKDPFSGEERWFPAKPASVRIKARPLKKLKDAAAG"
     atgccgactt ccgcaaaaaa ggtggccaag aaggctgctg ccccggtacc cgccaagaag        60
     gttgctgcaa agaaagttcc tgcgaagaag gccgtcgcag ctaagaaggt cgccgtgaag       120
     gcgtccagcg ctccggcgcc gatcaaggac accttcacga aggcctcgct ggctgcacac       180
     gtcgctgaac gcgctgctgt ggaaccgaag accgccaagg ctgttctggc tgcgctcgaa       240
     gacacgatcc tcggcgccgt gcacaagaag ggcgctggcg aattcacgct gtcgggtctt       300
     ctgaagatcg tcgtgcaagc tgtcccggcg aagaagaagc gcttcggcaa agacccgttc       360
     tcgggcgaag agcgttggtt cccggccaag ccggctagcg tgcgcatcaa ggcacgtccg       420
     ctgaagaagc tgaaagacgc tgctgcaggc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page