(data stored in ACNUC7421 zone)

EMBL: CP001053.PE445

CP001053.PE445       Location/Qualifiers
FT   CDS_pept        511329..512279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4444"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   bxe:Bxe_B0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4444"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18820"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE28"
FT                   /protein_id="ACD18820.1"
FT                   /translation="MLSRTADHLFWMARYMERAENTARMLDINLKALLLPQTPDQEARA
FT                   QRSVLRISELETAFAQRHDEPTRENVLDFMVADATNPSSIHSCLQAARENARAVRGTLT
FT                   TEWWETINDTWLEFNERASSGQAASNPGALFEWVKFRSHLSRGVTIGTALQDDAFFFTQ
FT                   LGTFLERADNTARILDVRFADVEPNSRDAARQLEDFYYWTSILSSVSALEIYRKVYRDV
FT                   VTPARVVELMILNQQMPRSLLASLEGVCVNLAMLRTSGSNQCERFAGKLRAELVYSDIR
FT                   QIFEAGLHAYLTQFLARVFELGNLVARTYLMLPVA"
     atgctaagcc gaaccgccga tcaccttttc tggatggccc gctacatgga gcgcgcggag        60
     aacaccgccc gcatgctcga tatcaacctg aaggcgctgc tgttgccgca gacgcccgac       120
     caggaggcgc gcgcgcaacg ctcggtgctg cgcatctccg aactcgaaac cgcgtttgcg       180
     cagcgccacg acgaaccgac tcgcgaaaac gtgctcgatt tcatggtggc cgatgcgacc       240
     aatccgtcga gtatccattc gtgtctgcaa gccgcgcgcg aaaacgcccg cgccgtgcgc       300
     ggcacgttga cgaccgagtg gtgggaaacc atcaacgata catggctcga attcaatgag       360
     cgcgcttcgt ccggccaggc cgcgagcaat ccgggcgcgc tgttcgagtg ggtcaagttc       420
     cgctcgcatc tgtcgcgcgg cgtgacgatc ggcaccgcgc tgcaggacga cgcgttcttc       480
     ttcacgcagc tcggcacttt cctcgaacgc gccgacaaca ccgcgcggat tctcgacgtg       540
     cgctttgccg acgtcgaacc gaattcacgc gatgccgcgc gccagctcga agacttctat       600
     tactggacct cgatcctgag ttcggtgtcg gcgctggaga tctatcgcaa ggtgtatcgc       660
     gatgtcgtca cgccggcgcg cgtggtcgaa ctgatgatcc tgaatcagca gatgccgcgt       720
     tcgctgctgg cgtcgctcga aggcgtctgc gtgaatctgg cgatgctgcg cacctccggc       780
     tcgaatcagt gcgaacggtt cgccggcaag ctgcgcgccg aactcgtcta ctccgacatc       840
     cggcagattt tcgaagccgg cctgcacgcc tatctgacac agttcctcgc tcgcgtgttc       900
     gagctgggca atctggttgc gcgtacctat ctgatgttgc cagtcgcctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page