(data stored in ACNUC7421 zone)

EMBL: CP001053.PE447

CP001053.PE447       Location/Qualifiers
FT   CDS_pept        513266..514138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18822"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE30"
FT                   /protein_id="ACD18822.1"
FT                   /translation="MTYCVAMSVDDGLVFLSDTRTNAGVDHISTARKMSVFEQPGERML
FT                   TLLGAGNLSLTQAVLHELSEPTDPSLPTLWNAPTMADAARVIGRAVRCVHQREAEALQE
FT                   FGVDFNCSFILGGQIAGNRPRLFMIYAAGNFIEASAVNPYFQIGEAKYGKPIIDRVLTP
FT                   STPLDEAAKCALISMDSTLRSNLSVGLPLDLLVYQKDTLHVTRFVSIDHDNAYFEMIHR
FT                   TWGERLRQVFGEIPDPDWQESPNVPLLQRERALVLHRAPVGADGIEHELDAKPAQTLAQ
FT                   AERGKAQRK"
     atgacttact gtgtcgcgat gtccgtcgac gacggtctcg tgttcctctc ggacacgcgc        60
     accaacgcgg gcgtcgatca catcagcacc gcgcgcaaga tgtcggtgtt cgagcagccg       120
     ggcgagcgta tgctcacgct gctgggcgcc ggcaatctgt cgctgactca agcggtgctg       180
     cacgagctgt ccgagcccac ggatccttcc ctgcccacgc tctggaacgc gccgaccatg       240
     gccgacgcgg cccgcgtgat cggccgcgcg gtgcgttgcg tgcatcagcg cgaggcggag       300
     gcgttgcagg aattcggcgt cgacttcaat tgcagtttca ttctaggcgg gcagatcgcg       360
     ggcaaccggc cgcgcctgtt catgatttac gcggcgggca atttcatcga ggcgtcggcg       420
     gtgaatccgt atttccagat cggcgaggcc aaatacggca agccgatcat cgaccgcgtg       480
     ttgacgccgt ccacaccgct cgacgaagcc gccaaatgcg cgctgatctc catggactcg       540
     acgctgcgct cgaatctgtc ggtcggcttg ccgctcgatc tgctggtcta ccagaaggac       600
     acgctgcacg ttacgcgctt cgtctcgatt gatcacgaca acgcgtactt cgagatgatt       660
     caccggacgt ggggcgagcg gctgcgtcag gtgttcggcg agattcccga tccggactgg       720
     caggaatcgc cgaatgtgcc gctgctgcag cgggagcggg cactggtgct gcaccgcgcg       780
     ccggtgggcg ccgatggcat cgagcatgaa ctcgatgcga aacccgcgca gacgttggcg       840
     caggcggagc ggggcaaagc gcagcggaag taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page