(data stored in ACNUC7421 zone)

EMBL: CP001053.PE45

CP001053.PE45        Location/Qualifiers
FT   CDS_pept        complement(49058..49852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4034"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0494 ABC nitrate/sulfonate/bicarbonate
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18420"
FT                   /db_xref="GOA:B2TE99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE99"
FT                   /protein_id="ACD18420.1"
FT                   /translation="MNQPLSRDTPAIEMRNVSCRFISPDGKATIALRDFSMSVARGEFV
FT                   AVVGPTGCGKSTTLSMITGLLKPTTGEVRVMGAPVDGIDPRIGFVFQADAVFPWRSVLD
FT                   NVAAGPLYRGRSKSAAYDEANEWLRRVGLDKFGKHYPHQLSGGMRKRVALAQTFINKPE
FT                   ILLMDEPFSALDMQTRTLMQDELLQLWGGAGSVVFVTHDLEEAIALADRVFVLTARPAT
FT                   LKKVYEIDLPRPRVTSEIRYEPRFIEISRDIWHDLREEVQIG"
     atgaatcaac ctttgtcacg cgatacgcca gcgatcgaaa tgcgcaacgt ctcgtgccgt        60
     ttcatttctc ctgatggcaa ggcgaccatt gcgttacgcg acttcagcat gtcggtggcg       120
     cgcggcgaat tcgtcgcagt ggtcgggccc acgggttgcg gcaaatccac cacgctcagc       180
     atgattaccg gcttgctgaa gcccaccacg ggcgaagtgc gcgtgatggg cgcgccggta       240
     gacggcatcg atccgcgtat cggtttcgta tttcaggccg acgccgtgtt cccgtggcgt       300
     tcggtgctcg acaacgtggc ggcgggtccg ctgtatcgcg gacgttccaa atccgccgcg       360
     tacgacgagg ccaacgaatg gctgcgccgt gtgggcctcg acaaattcgg caagcactat       420
     ccgcatcaac tgtccggcgg catgagaaag cgcgtggcgc tcgcgcagac cttcatcaac       480
     aagccggaaa tcctgctgat ggacgagccg ttctcggcgc tcgacatgca aacccgcacg       540
     ctgatgcagg acgaactgct gcaactgtgg ggcggcgcgg gctcggtggt attcgtcacg       600
     cacgatctcg aagaagcgat tgcgctcgcc gaccgtgtat tcgtgctgac cgcacgcccg       660
     gcgacgctga agaaagtgta cgaaatcgat ctgccgcgtc cgcgggtcac ctcggagatt       720
     cgctacgagc cgcgtttcat cgaaatttcg cgcgacatct ggcacgacct gcgcgaagaa       780
     gtgcagatcg gttaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page