(data stored in ACNUC7421 zone)

EMBL: CP001053.PE450

CP001053.PE450       Location/Qualifiers
FT   CDS_pept        517568..518107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4449"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_B0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18825"
FT                   /db_xref="GOA:B2TE33"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE33"
FT                   /protein_id="ACD18825.1"
FT                   /translation="MHSHELVQRLDVIAAEQLGAHLPAHVVEQLPAQGVTVFSVTDDAS
FT                   DTAAFSERYGFGLEDCANTIVIRYKKEGAEHYAAVVSLGSLRLDINGAVKAALGAQRLS
FT                   FAKREAAVEHSGMEFGGITAFGLPDDWRILVDAAVMERTQIVMGAGVRAAKLLLSPDVL
FT                   RQWPRCEVAALTLPAE"
     atgcactcgc acgaactcgt acagcggctg gacgtcattg cagcggaaca attgggcgcg        60
     catttgcctg cgcatgtggt cgaacaattg ccggcgcaag gcgtcacggt tttctccgtc       120
     accgacgacg cgtcggatac cgccgcattc agcgagcgtt acggtttcgg cctggaagac       180
     tgcgcgaaca cgatcgtgat ccgctacaag aaagagggcg ccgagcatta cgcggcggtg       240
     gtctcgctag gttcgctgcg gctcgacatc aacggcgccg tgaaggcggc gctgggcgcg       300
     cagcggcttt ctttcgctaa gcgcgaggcg gcggtcgagc acagcggcat ggagttcggc       360
     ggtatcacgg ccttcggcct gccggacgac tggcgcattc tcgtcgatgc cgccgtcatg       420
     gagcggaccc agatcgtcat gggcgcgggc gtgcgagcgg ccaagttgtt gctgtcgcct       480
     gacgtattgc ggcagtggcc gcgctgcgaa gttgccgcgc tgacgctgcc ggcggagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page