(data stored in ACNUC7421 zone)

EMBL: CP001053.PE451

CP001053.PE451       Location/Qualifiers
FT   CDS_pept        518424..519983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4450"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bxe:Bxe_B0771 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18826"
FT                   /db_xref="GOA:B2TE34"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE34"
FT                   /protein_id="ACD18826.1"
FT                   /translation="MERFRLKVRLWLALAVMCMGILAIGLWGAFKTRDTMIADRQAELK
FT                   SVVSVAYSVLDRYNGLVAAGSMPLADAQRTAMADLRAMRYDGAGGYLVIEDAHARVLMH
FT                   GVRADLEGKDMSGFTDPQGRHVFKDGSDLAQREGEGFIHLQFLKPGSNEMAPKINYVRL
FT                   YKPWDWTIVTGVFTDDIDAAFYTTLVQYVGAALLLCLVVSLVIGVILRSILRQLGGEPA
FT                   YAAQIAARIADGELDVIVDTKAGDDTSLLAAMQRMQQRLAHAITQIRGGATLISTVSNE
FT                   IAAGNADLSRRTEQQATALGETASSMEQITATVKQNADNAKQASQLAHNASETAARGGE
FT                   VVDQVVETMRGISQSSHRIGDIIGVIEGIAFQTNILALNAAVEAARAGEEGRGFAVVAG
FT                   EVRSLAQRSAAAAKEIKTLIEESAAQIEGGSQYVSRAGETMHEVVQAVRRVTDIMGEIS
FT                   AASVEQSSGIEQVNIAVASMDQTTQQNAALVEEASASADVLKAQTGQLSAAIAVFTLPE
FT                   TR"
     atggaacggt ttcgcctgaa ggtgcggctt tggctcgcgc tggcagtcat gtgcatgggt        60
     attctggcaa tcggcctgtg gggcgctttc aaaacacgcg acacgatgat cgccgatcgt       120
     caggccgaac tgaagagcgt ggtcagcgtc gcctacagcg tgctggatcg ctataacggc       180
     ctggtcgccg cgggttcgat gccgctcgcc gacgcgcaac gcacggcaat ggccgatctg       240
     cgcgcgatgc gctacgacgg cgcaggcggc tatctcgtga tcgaagacgc gcacgcccgc       300
     gtgctgatgc acggcgtgcg ggccgacctc gaaggcaagg acatgagcgg cttcacggat       360
     ccgcaagggc gtcatgtgtt caaggacggc tccgatctcg cccagcgcga aggcgaaggc       420
     ttcatccacc tgcaattcct gaaaccgggc tccaacgaaa tggcgccgaa gatcaattac       480
     gtgcggctgt acaagccctg ggactggacg atcgtcaccg gcgttttcac cgacgatatc       540
     gacgccgcgt tctacaccac gctcgtccag tacgtaggcg ccgcgttgct gctgtgcctg       600
     gtggtgtcgc tcgtgatcgg cgtgatcctg cgcagcatct tgcggcaact cggcggcgag       660
     ccggcatacg cggcgcagat cgccgcgcgc atcgccgacg gtgagctcga cgtgatcgtg       720
     gacaccaagg ccggcgacga caccagcctg ctcgccgcga tgcagcgcat gcagcagcgc       780
     ctcgcacacg cgatcacaca gattcgcggc ggcgcgacgc tgatctcgac agtctccaac       840
     gaaatcgccg ccggcaatgc ggacctgtcg cgccgcaccg agcagcaggc cactgcgctc       900
     ggcgaaaccg cgtcgagcat ggagcagatc accgcgaccg tgaagcaaaa cgccgacaac       960
     gcgaagcagg cgagccagtt agcgcataac gcgtcggaga cggcggcgcg cggcggcgaa      1020
     gtggtcgacc aggtggtcga gacgatgcgc ggcatttcgc agtcgtcgca tcggatcggc      1080
     gacatcatcg gcgtgatcga ggggattgcg tttcagacca atattcttgc tttgaacgcg      1140
     gcggtcgaag cagcgcgcgc cggcgaggaa ggacgaggct tcgcggtggt cgcgggcgaa      1200
     gtgcgcagcc tcgcgcagcg cagcgcggcg gccgcgaagg agatcaagac gctgatcgaa      1260
     gagtccgcgg cgcagatcga aggcggctcg cagtacgtga gccgcgccgg cgaaaccatg      1320
     catgaagtcg tgcaggcggt gcggcgcgtg acggacatca tgggcgagat cagcgcggct      1380
     tcggtggagc aaagctcggg catcgagcag gtcaatatcg cggtggcgag catggatcag      1440
     acgacccagc agaacgcggc gctggtggaa gaagcaagcg cgtcggcgga tgtgctgaag      1500
     gcgcagaccg gacagctcag cgcggcgatt gccgtgttca cgctgccgga aactcgctga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page