(data stored in ACNUC7421 zone)

EMBL: CP001053.PE455

CP001053.PE455       Location/Qualifiers
FT   CDS_pept        complement(523184..524572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4454"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: bxe:Bxe_B0773
FT                   putative FAD/FMN-containing oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18830"
FT                   /db_xref="GOA:B2TE38"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE38"
FT                   /protein_id="ACD18830.1"
FT                   /translation="MVNVSSSAVDELKTAMRGQVLLPGDAAFDEARSIWNAMIDRHPAI
FT                   ILRCAGVADIRQGVAFARDNGLPLAIRGGGHNIGGSALCNDGVVLDLSQMKSVQIDPTA
FT                   RRAYVEPGATLHDFDHEAQAFGLATPLGINSTTGVAGLTLGGGFGWLSRRYGMTVDNLV
FT                   SADVVTAEGELVHASADSHEDLFWAIRGGGGNFGVVTRFEFALHPVGPLVYGGLVVLPI
FT                   EQARDALLKYRAANATMPKELSVWAVLRLAPPLPFLPPEVHGKPVIVFAMCYTGAVESG
FT                   PSTVEFVRAFGTPLGEHLGPMPYVMWQQAFDPLLTPGARNYWKSHNLVDIPDGLIDALL
FT                   RSIDNLPSPQCEIFFGQIGKQTQSVPVEATAYSSRNTVYAMNVHGRWDDASDDARCVGW
FT                   ARAFFDAAAPFALGSVYVNFMTEEEGGRVADAYGPNYERLVAVKNRYDPRNLFRHNQNI
FT                   RPSA"
     atggttaatg tgtccagcag cgccgtcgac gaattgaaaa ccgccatgcg cggccaggtt        60
     ctgttgcccg gcgacgcggc cttcgacgaa gcgcgcagta tctggaatgc gatgatcgac       120
     cggcaccctg cgatcatcct gcgttgcgcg ggcgttgccg acatacgcca gggtgtggcc       180
     ttcgcgcgcg ataacggcct gccgctcgcg attcgcggcg gcggccacaa catcggcggc       240
     agcgcattgt gcaacgacgg cgtcgtgctc gacctgtcgc agatgaaatc ggtgcagatc       300
     gatcccacgg cacgtcgcgc gtatgtcgaa ccgggcgcga cgctgcacga tttcgatcat       360
     gaagcgcagg ccttcgggct cgccacgccg ctcggcatca actcgaccac cggtgtcgcg       420
     ggcctgacgc tcggcggcgg cttcggctgg ctgagccgca gatatggcat gacggtggac       480
     aacctggtct cggccgacgt cgtcaccgcc gaaggcgaac tggtccacgc aagcgccgat       540
     tcgcacgaag acctgttctg ggcgatacgc ggcggcggcg gcaatttcgg cgtcgtcacg       600
     cgcttcgagt tcgccctgca tccggtcggg ccgctggtgt acggcggcct cgtggtcctg       660
     ccgatcgagc aggcaaggga cgctctgctc aaataccgcg cggcgaacgc cacgatgccg       720
     aaggaactga gcgtgtgggc cgtgctgcgg ctcgcgccgc cgttgccgtt cctgccgccc       780
     gaagtccacg gcaagccggt gatcgtcttc gcaatgtgct ataccggcgc cgttgaaagc       840
     ggtccatcca cggtggaatt cgtgcgcgcc ttcggaacgc cgctcggcga acatctcgga       900
     ccgatgccgt atgtcatgtg gcaacaggcg ttcgacccgc tgctcacgcc gggcgcgcgc       960
     aactactgga aatcgcacaa cctcgtcgac atcccggacg gcctcatcga cgcgctgctc      1020
     cgctcaatcg acaacctgcc gtcgccgcaa tgcgagattt tcttcgggca gatcggcaag      1080
     cagacccaaa gcgttcccgt cgaggccacc gcctattcga gccgcaacac ggtgtacgcg      1140
     atgaacgtgc acggccgctg ggacgatgcg agcgacgacg cccgctgcgt cggctgggcc      1200
     cgcgcatttt tcgatgccgc ggcgccgttc gcgctgggca gcgtctacgt caacttcatg      1260
     acagaagaag aaggcggacg cgtcgccgat gcgtacgggc cgaactacga acgcctcgtc      1320
     gctgtaaaaa accgctacga tccacgcaat ctgttccgcc acaaccagaa catccggccg      1380
     tcggcgtag                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page