(data stored in ACNUC7421 zone)

EMBL: CP001053.PE463

CP001053.PE463       Location/Qualifiers
FT   CDS_pept        533398..533748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4462"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   bxe:Bxe_B0780 putative FKBP-type peptidyl-prolyl
FT                   cis-transisomerase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18838"
FT                   /db_xref="GOA:B2TE49"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE49"
FT                   /protein_id="ACD18838.1"
FT                   /translation="MAAAPTTEKLPSGVVVEHLTQGTGAQPAAEDVVKVNYRGTLANGT
FT                   EFDSSAKHGGPATFPLNRVIPCWTQGVQKMKVGGKAKLTCPAATAYGDRGVGVIPPNSD
FT                   LTFEVELVGIVK"
     atggccgccg cgcccaccac cgagaaactg ccttccggcg tcgtggtcga acatctgact        60
     caaggcacag gcgcccaacc ggccgccgaa gatgtagtga aggtcaacta ccgcggcacg       120
     ctcgccaacg gtaccgagtt cgatagctcg gcgaaacacg gcggcccagc cacgttcccg       180
     ctgaaccgcg tgattccgtg ctggacgcaa ggcgtgcaga agatgaaggt gggcggcaag       240
     gccaaactga cttgcccggc ggcgactgct tacggcgatc gcggcgttgg cgtgattccg       300
     ccgaacagcg acctgacctt cgaggtcgag ctggtcggta tcgtcaagta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page