(data stored in ACNUC7421 zone)

EMBL: CP001053.PE466

CP001053.PE466       Location/Qualifiers
FT   CDS_pept        534930..536003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4465"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18841"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE52"
FT                   /protein_id="ACD18841.1"
FT                   /translation="MNIDFHYGVVYIAARVAGMTADNAITVAHACQYVDDATTAGILRF
FT                   KGGETFERFATAHKLFDYATTEDDKNRLVWTPFHFLPAAEGSTLHEKAVCRPDSAVARE
FT                   VVRRAILRRDTETGLHRLGVTLHTYVDTWAHQGFAGIESPWNRVHLLEAQDCTRKGWFA
FT                   KLRLASEHLIEHIEEDVLTVALPVGHGAALHYPDQPWAKWHYIDGRNEFVQRHNLPEFV
FT                   QAAEMACRAVRAYLAGRQDFENLPGMPDDVTDVLTDLLNTNRLEDDNDRLRHICRVVKA
FT                   GGIPGLKESIPDYVPKGPGSWKYLATGLKFDDDTGDKPEWTNAFEKSDYRLFHDAVKQH
FT                   RFVTTQEILPTHGLRIA"
     atgaatatcg actttcatta cggtgtcgtc tatattgccg cgcgcgtggc cgggatgacg        60
     gccgacaacg cgatcaccgt ggcgcacgcc tgccaatatg tggacgatgc gacgaccgcg       120
     ggcatattgc gcttcaaggg cggcgagacg ttcgaacgct tcgccaccgc gcacaagctg       180
     ttcgattacg ctactaccga ggacgacaag aaccggctcg tgtggacgcc ctttcatttt       240
     ctgccggcgg ccgagggctc gacgttgcac gaaaaggccg tgtgccggcc cgatagcgcg       300
     gtcgcgcgcg aagtggtgcg gcgcgcgatc ctgcgccggg acaccgaaac gggattgcat       360
     cggctgggcg tgacgcttca cacgtatgtc gatacatggg cgcatcaagg cttcgccggg       420
     atcgaaagtc cgtggaatcg ggttcatctg ctggaagctc aggactgcac ccgcaaaggc       480
     tggttcgcca aactcagact cgccagcgag cacctgatcg aacacatcga ggaggacgtg       540
     ctgaccgtcg cgctgcccgt cggtcacggt gctgccttgc actatcctga ccagccgtgg       600
     gcaaaatggc attacatcga cggtagaaac gagttcgtcc agcgacacaa tctgccggaa       660
     ttcgtgcaag cggccgagat ggcgtgccgc gcggtgcgcg cctatctggc ggggcggcaa       720
     gacttcgaga atctgcccgg catgccggac gatgtgacgg acgtgctcac ggacctgctc       780
     aatacgaacc ggctggagga cgacaacgat cgcttgcggc acatttgccg cgtcgtaaag       840
     gccggcggta ttccgggttt gaaagagtcg attccggact atgtgccaaa aggtcccggc       900
     tcctggaagt atctggccac cggtttgaag ttcgacgacg ataccggcga caagcccgaa       960
     tggacgaacg ctttcgagaa aagcgattac cgtctgtttc acgacgcggt caaacagcac      1020
     cgcttcgtga ccacgcagga gattctgcca acgcacggat tgcgaatcgc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page