(data stored in ACNUC7421 zone)

EMBL: CP001053.PE469

CP001053.PE469       Location/Qualifiers
FT   CDS_pept        537221..538072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4468"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bxe:Bxe_B0784 putative histone-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4468"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18844"
FT                   /db_xref="GOA:B2TE45"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE45"
FT                   /protein_id="ACD18844.1"
FT                   /translation="MPTLEQIQAKLKKLQAQADVLLARKAQVAVDQIRDLMLKHGLTTA
FT                   DIEAKAKARRAARGLNGGGKAKAVSSGKAVAKYRDHKTGATWTGHGRAPGWIASVKDRT
FT                   QFLIEGASELKSAAKAAVTHAKGSKGQPKGAQPPKYINPKTGATWSGRGPAPAWLASVK
FT                   DRSKFLIDSASAAVADAGHQAAKKAGKVKSAATGGVVSKKAAARKVVAKKAGAAKKTVA
FT                   KKATAATRQVAAKKGAVKPAAKKSAVAKAARKAPARKAAAKKAAATSAPATPAAAPASA
FT                   GA"
     atgcccacgt tagagcaaat ccaagcaaag cttaaaaagc ttcaggcgca agctgacgtt        60
     cttctggcca ggaaagcgca agtcgcggtc gaccagattc gtgacctgat gctcaagcat       120
     ggcctgacta ccgcggatat cgaagccaag gcaaaagccc ggcgcgccgc gagaggcttg       180
     aatggcggcg gcaaggcgaa agccgtgagc tccggtaagg cagtggcaaa gtaccgcgac       240
     cataaaaccg gcgcgacctg gacaggccac ggccgcgcac cgggttggat tgccagtgtg       300
     aaagaccgca cccagttcct gatcgaaggc gcgagcgaat tgaaatcggc ggcaaaggct       360
     gctgtcaccc atgcgaaagg cagcaaaggt cagccgaaag gcgcgcaacc gcccaagtac       420
     atcaatccga aaactggcgc gacctggagc ggccgcggcc cggccccggc atggcttgcc       480
     agcgtcaagg accgtagcaa attcctgatc gatagcgcct cggcagccgt ggcggatgcg       540
     ggtcaccaag ccgcgaagaa ggccggcaaa gtgaaatcgg cggcaactgg cggtgtagtg       600
     agcaagaaag ccgcggctcg aaaagtcgtg gcaaagaaag caggcgcggc gaagaaaaca       660
     gttgcaaaga aagccaccgc ggcaaccaga caagtagcgg caaagaaagg cgccgtaaag       720
     ccggcggcga agaagagcgc cgtggccaaa gcagcgagga aagcaccggc tcgtaaagcc       780
     gctgccaaaa aagctgctgc gacgagtgcc ccggccacgc cggcagccgc accggcgtca       840
     gccggcgcat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page