(data stored in ACNUC7421 zone)

EMBL: CP001053.PE47

CP001053.PE47        Location/Qualifiers
FT   CDS_pept        51162..51839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4036"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0496 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18422"
FT                   /db_xref="GOA:B2TEA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA1"
FT                   /protein_id="ACD18422.1"
FT                   /translation="MKLLLIEDNPTLAHWLAKMLEQEAFALDTVQDGDAADQLLRTNHY
FT                   DVILLDLNLPKLSGKNVLRRLRQRGDATPVLILTASGSIDEKVELLGAGADDYLVKPFE
FT                   VRELIARIKVAIRRQSPSKASEVVCGDLTFDIDTRQFTLKGAPLNVTPRERSVLETLIL
FT                   RLGKTVTKPALVDAIFTLADEPSEDAVEIYISRLRKKLDGSSAAIVTLRGLGYLLRKKE
FT                   DDQ"
     atgaagctgc tgctcatcga agacaacccc acgctggcgc actggctcgc gaagatgctg        60
     gagcaggagg cgttcgcgct cgacaccgtg caggacggcg acgccgccga ccagctgctg       120
     cgcaccaatc actacgacgt gatcctgctc gacctgaatc tgcccaagct gtcgggcaag       180
     aacgtgctgc ggcgactgcg tcagcgtggc gacgcgacgc cggtgctgat tctgacggcg       240
     agcggttcga tcgacgaaaa agtggagttg ctcggcgccg gcgcggacga ttacctggtc       300
     aagccgttcg aagtgcgcga gttgatcgcg cggatcaagg tggcgatccg caggcagtcg       360
     ccctccaagg cgagtgaagt ggtatgcggc gatctcacgt tcgacatcga cacgcggcag       420
     ttcacgctga agggcgcgcc gctgaacgtc acgccgcgcg agcgctcggt actcgaaacg       480
     ttgatcctgc gtctgggcaa aaccgtgacg aagccggcgc tggtcgacgc gatcttcacg       540
     ctcgccgacg agccgagtga agacgccgtc gaaatctaca tttcgcgtct gcgcaagaaa       600
     ctcgacggca gttcggcggc gatcgtgacg ctgcgcgggc tcggttatct gctgcgcaag       660
     aaagaagatg accaatag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page