(data stored in ACNUC7421 zone)

EMBL: CP001053.PE474

CP001053.PE474       Location/Qualifiers
FT   CDS_pept        complement(541743..542828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4473"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bmu:Bmul_5129 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18849"
FT                   /db_xref="GOA:B2T7U7"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U7"
FT                   /protein_id="ACD18849.1"
FT                   /translation="MTVRSKLKSNTALYGVYAAIATVAFATAFTAATAASAVFSGGAKQ
FT                   RAFDELNTSRPLAALGSEQQCARYAGLPARWRDDPKAGMVHLHGGDFVFGSKLGYEDER
FT                   PAGDGKTRVAGFWIDQTDVTNAQFAAFVKATGYVSDSERQGGAVVFHTPTRDEMNARDL
FT                   AWWTWVKGAAWNHPTGPGSTLEGRLNQPVTMVTQADALAYARWLGRDLPTEAEWEYAGK
FT                   AGREGADLDTAPRDGHGKPSANYWQGVFPVLNTNEDGHIGLAPVGCYAANDFKLYDMIG
FT                   NAWEWTKDVYTGPHQSHTNGDTAEVAPLSRKHDTPMVIKGGSFLCSRDYCVRYRAASRE
FT                   QQEADLPASHIGFRTVLRDAS"
     atgaccgtca gatccaagtt gaagagcaac acggcgctct acggcgtgta tgcggcgatc        60
     gccacggtcg cgttcgccac cgcttttacc gcggcgacgg ccgcttcggc ggtctttagc       120
     ggcggtgcca aacaacgcgc gttcgatgaa ctcaacacgt cgcgcccgtt ggcggcgctc       180
     ggttccgaac agcaatgcgc gcgctatgcc ggtctgcccg cgcgctggcg cgacgatccg       240
     aaggccggca tggtgcacct gcatggcggc gacttcgtat tcggcagcaa gctcggctac       300
     gaagacgagc gtccggccgg agacggcaag acgcgcgtcg ccggtttctg gatcgatcag       360
     accgatgtga cgaatgcgca gttcgcggcg ttcgtgaaag cgacgggcta tgtcagcgat       420
     tcggagcgcc agggtggcgc cgtggtgttt cacacgccga cgcgcgacga gatgaacgca       480
     cgtgatcttg cgtggtggac atgggtaaaa ggcgccgcgt ggaatcatcc gaccggcccc       540
     ggcagcacac ttgaaggccg cctgaaccag cccgtgacga tggtcacgca agccgacgcg       600
     ctcgcctacg cgcgctggct cggccgcgat ctgcccaccg aggccgagtg ggaatacgcg       660
     ggcaaagcag gccgcgaagg cgcggacctc gacaccgcgc cacgcgatgg acacggcaag       720
     ccgagcgcga attactggca aggcgtgttt cccgtgctca acacgaatga ggacggtcac       780
     atcggtctcg cgcccgtcgg ctgctatgcc gccaacgact tcaagctcta cgacatgatc       840
     ggcaatgcat gggaatggac caaggacgtc tacacgggtc cgcaccagtc gcacaccaat       900
     ggcgacaccg cggaggtcgc gccgctcagc cgcaaacacg acacgccgat ggtcatcaaa       960
     ggcggttcgt ttctatgctc gcgcgactat tgcgtgcgct atcgcgcggc gtcgcgcgaa      1020
     cagcaggaag cggatttgcc ggcgtcgcat atcggttttc gcacggtgtt gagggacgcg      1080
     tcatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page