(data stored in ACNUC7421 zone)

EMBL: CP001053.PE476

CP001053.PE476       Location/Qualifiers
FT   CDS_pept        complement(544941..545489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4475"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: bxe:Bxe_B0787 conserved hypothetical signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4475"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18851"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7U9"
FT                   /protein_id="ACD18851.1"
FT                   /translation="MKRSTPLRLASLLICFAVTAIHAHAEPARVNRGHDPFFQISKAIS
FT                   DCPVPLGPLETEKEWLDDSHYRIERGNSCWVEGRCRLSNAYLYDVEIAEAVQRRLTNIN
FT                   FATHWREQSTLWLTLQRRFIYVEGCVAPGFAKQSFLTELAKTADVERVIDDTVTNPHAA
FT                   QLPYKTLANPDKPVLDPGN"
     atgaaacgct cgaccccatt gcggctagcg agtctgctga tctgtttcgc cgttactgct        60
     attcacgcgc atgccgaacc ggcgcgcgtc aatcgcggtc acgacccgtt ctttcagatc       120
     tccaaagcga tcagcgattg tccggtgcca ttggggccgc tcgaaaccga gaaagaatgg       180
     ctcgacgaca gccattaccg gatcgaacgc ggcaatagct gctgggtgga aggtcgctgc       240
     cgtttatcga acgcctatct gtacgacgtg gaaatcgccg aggccgtgca gcgtcgactc       300
     accaacatca atttcgccac gcactggcgc gaacaatcga cgctctggct gacactgcaa       360
     cgccgtttca tctatgtgga aggctgcgtt gcgccgggct tcgccaaaca gagcttcctc       420
     accgagctcg cgaaaaccgc ggacgtcgag cgggtgatcg acgacaccgt caccaatccg       480
     cacgccgcac aactccccta caaaacgctt gcgaatccgg acaagccggt gctcgatccg       540
     ggcaactag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page