(data stored in ACNUC7421 zone)

EMBL: CP001053.PE477

CP001053.PE477       Location/Qualifiers
FT   CDS_pept        complement(545599..546246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4476"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bxe:Bxe_B0788 two
FT                   component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4476"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18852"
FT                   /db_xref="GOA:B2T7V0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V0"
FT                   /protein_id="ACD18852.1"
FT                   /translation="MNDASPAIARLILVDDHPLVRDGLRARLEAVRHLEVVGEAGNAQE
FT                   ALALAASAEPHLVLMDVGMNGMNGIALAGMFHERFPAIRVLMLSMHDNLEYVTQAVRAG
FT                   ASGYVLKDSPSTEIIQAIGAVLEGKQFFSAGLGARLIQASAMQSPVERLTPRERDILDA
FT                   LAEGLSSKQIAQRNDLSVRTVETHRLNLKRKLDIEGQAELIKFAVENRRTNR"
     atgaacgacg cctcacccgc tatcgcccgc ctgattctcg tcgacgatca tccgctcgtg        60
     cgcgacggtt tgcgcgcgcg gctcgaagcg gtgcgccacc tcgaagtggt cggcgaagcc       120
     ggcaatgcgc aggaagcgct cgccctcgcc gcgagcgcgg agcctcatct cgtgctgatg       180
     gatgtcggca tgaacggaat gaacggcatc gcgctggccg gcatgtttca cgaacgcttc       240
     ccggcgattc gcgtgctcat gctgtcgatg cacgacaatc tcgagtacgt gacccaggca       300
     gtgcgcgcgg gtgcgagcgg ctacgtgctg aaggattcgc cttccaccga gatcatccag       360
     gcaattggcg cggtgctcga aggcaaacag tttttcagcg cgggacttgg cgcgcgtctg       420
     attcaggctt cggctatgca gtcgcccgtc gaacggctca cgccgcgcga gcgcgacatt       480
     ctcgatgcgc ttgcggaagg cttgtcgagc aaacagatcg ctcagcgcaa cgatctctcc       540
     gtgcggacgg tggaaacgca tcggctgaat ctgaagcgca agctcgatat tgaaggtcag       600
     gccgaattga tcaagttcgc ggtggagaac cggcgcacga accggtga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page