(data stored in ACNUC7421 zone)

EMBL: CP001053.PE479

CP001053.PE479       Location/Qualifiers
FT   CDS_pept        547915..548112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4478"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18854"
FT                   /db_xref="GOA:B2T7V2"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V2"
FT                   /protein_id="ACD18854.1"
FT                   /translation="METSQPAGRSWLWLILLLPYIALLWLPFYNDTRPSFAGFPFFYWY
FT                   QFLWVPLTSLLIYAVYRGVK"
     gtggagacat cccaacctgc cggccgttca tggctatggc tgatcctgct gctcccatat        60
     atcgcattgc tgtggctgcc gttttataac gacacgcgtc cgtcgttcgc gggctttcct       120
     ttcttttact ggtatcagtt cttgtgggtg ccgttgacct cgctactgat ttacgccgtg       180
     taccgaggtg tcaaatga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page