(data stored in ACNUC7421 zone)

EMBL: CP001053.PE483

CP001053.PE483       Location/Qualifiers
FT   CDS_pept        552517..555135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4484"
FT                   /product="protein of unknown function DUF802"
FT                   /note="PFAM: protein of unknown function DUF802; KEGG:
FT                   bpm:BURPS1710b_A0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18858"
FT                   /db_xref="GOA:B2T7V6"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V6"
FT                   /protein_id="ACD18858.1"
FT                   /translation="MSRYRIDLVVFLAGLAAVCWIAAGYLGSNPLALAVTLLIGVCYLA
FT                   GSLELHRYNQATATLTQAVAGLSGPPPSLGTWLEPLHPSLRHAARLRVEGERVALPGPA
FT                   LTPYLVGLLVLLGMLGTLLGMVVTLRGTGMALESATDLQAIRASLAAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALCRRERLQAAQMLDVKIATILRIYSQSHQREEAFRLLQRQSEVM
FT                   PTLVDRLQTMMSAIEQQSLALNERQIASQEAFHGRAEAAYTRLASSVEQSLKESVADST
FT                   RAAGAALQPVMQATMAGLARETAVLHDTVTHAVQRQLDGLSSGFETTTTTVADIWNKAL
FT                   AGHQRSSEELAQHLRASLDRFTDTFEQRSAGLLDGVSARLESTAGNVAQAWNEALARQE
FT                   SAGEKLAANNQQAFAAAAATFEQHAASLLRGVGQSHVDLQTELASKDEQRLAAWTETLG
FT                   AMAATLSKAWEQSGAQTASRQQEICETLAQTARDISAQTQAHASNTIAEIDRLVEAAAE
FT                   APKAAANLQAELASRDQQRLAAWTDTLAAMAATLSKEWAQSGAQTASRQQEICEALAQT
FT                   ARDISAQTQAHASNTIAEIDRLVQAAAEAPKAAANLQAELASRDQQRLAAWTEALGAMA
FT                   NTLSAEWEQAGARTASRQQEICETLAQTARDISAQTQAHASETIAEIGQLVQAASEAPK
FT                   AAAEVVAELRQKLSDSMVRDTAMLQERSRLLETLETLLDAVNHASTEQRTAVDALVATS
FT                   ADLLERVGTRFTDKLEHETGKLGSVAAQVTGSAVEVASLGEAFGTAVQVFGESNDKLVT
FT                   HLQRIETALDKSLARSDEQLAYYVAQAREVIDLSVMSQKQIVEDLQQLAGRRASAGVEA
FT                   A"
     atgtccagat atcgtattga tctcgttgtg tttttggcag gtctggccgc tgtgtgctgg        60
     atcgccgccg gctacctcgg ttcgaacccg ctggcgctgg ccgtcacctt attgatcggc       120
     gtgtgctatc tggcgggttc gctcgaattg caccgctaca accaggccac cgccacgctc       180
     acgcaggcgg tcgccgggct gtccgggccg ccgccgagcc tcggcacatg gctcgagccc       240
     ttgcatccga gcctgcgcca cgcggcgcgc ctgcgcgtcg agggcgagcg ggtggccttg       300
     ccgggtccgg cactcacgcc ttacctggtc ggcttgctgg tgctgctggg catgctcggc       360
     acgttgctcg gcatggtggt gaccttgcgc ggcaccggca tggcgctgga aagcgcgacc       420
     gacctgcagg cgatccgcgc ttcgctcgcg gcgccggtca agggtttggg ctttgcgttc       480
     ggcacctcga ttgcgggcgt ggcgacctcc gcgatgctgg ggctgctgtc cgcgctgtgc       540
     cggcgtgagc gcctgcaggc cgcgcagatg ctcgacgtga agatcgcgac gatcctgcgc       600
     atctactcgc agagtcatca gcgtgaagag gctttcaggc tcctgcagcg tcagtccgag       660
     gtgatgccca cgctggtcga ccgtctgcag acgatgatgt cggccatcga gcaacagagc       720
     ctcgccttga acgagcggca gatcgccagc caggaggctt ttcacggcag ggccgaggcc       780
     gcttatacgc gcctcgcgag ttcggtcgag cagtcgttga aggagagcgt ggccgacagc       840
     acgcgggccg ccggcgcggc gctgcaaccg gtcatgcaag ccacgatggc cggcctcgcg       900
     cgcgagacgg cggtgttgca cgacaccgtc acgcacgccg tgcagcggca actggacggc       960
     ctgtcgagcg gcttcgaaac caccaccacg accgtcgcgg atatctggaa caaggcgttg      1020
     gctgggcatc agcgttcgag cgaggaactg gcgcagcatc tgcgcgcctc gctggatcgc      1080
     ttcaccgaca ctttcgagca acgctcggcc ggtctgctgg acggcgtttc cgcgcggctg      1140
     gaaagcacgg cgggcaacgt cgcgcaggcc tggaacgagg cgctggcgcg tcaggagagc      1200
     gccggcgaaa agctcgcggc gaacaaccag caggcgtttg cagcggccgc ggcgactttc      1260
     gagcagcacg cggcgtcgct gctgcgtggc gtaggtcagt cgcacgtgga cttgcagacc      1320
     gagctggctt cgaaagatga acaacggctc gccgcctgga ctgagacact cggtgcgatg      1380
     gcggcgacct tgagcaaggc gtgggaacag tcgggcgcgc aaaccgcgag ccgtcagcag      1440
     gaaatctgcg agacgctggc gcaaacggcg cgtgatattt cggcacaaac gcaagcgcac      1500
     gccagcaaca cgatcgcgga gatcgacagg ctcgtcgagg ccgcagccga agcgccgaaa      1560
     gcggcggcga acctgcaggc tgagttggcc tcgcgggacc agcagcgtct ggcggcctgg      1620
     accgacacgc tcgctgcgat ggccgccacg ttgagcaagg aatgggcgca gtcgggcgcg      1680
     caaaccgcgt cacgtcagca ggaaatctgc gaggcgctgg cgcaaacggc acgcgatatt      1740
     tccgcccaaa cgcaagcgca cgcgagcaat acgattgctg aaatcgaccg gctcgtgcag      1800
     gccgcggcgg aagcgccgaa ggccgcggca aatctgcaag ccgaactggc ctcgcgcgat      1860
     cagcagcgtc tggccgcctg gaccgaagcg ctcggcgcaa tggccaacac cttgagcgcg      1920
     gaatgggagc aagcgggcgc acgaaccgcg agccgtcagc aggaaatttg cgagacactc      1980
     gcgcaaaccg cgcgcgacat ctccgcccag acacaggcgc acgccagcga gacgatcgcc      2040
     gagatcggcc aactcgtgca agccgcttcg gaagcgccga aggccgcagc cgaagtcgtc      2100
     gccgaactgc gtcagaaact ctccgacagc atggtccgcg ataccgcgat gctgcaggag      2160
     cgcagccgct tgctggaaac gctggaaacc ctgctcgacg ccgtcaatca cgcatccacc      2220
     gagcagcgca cggcggtcga cgcgctcgtc gccacgtcgg cggatttgct ggagcgcgtg      2280
     ggcacgcgct tcaccgacaa gctcgaacac gaaaccggca agctcggctc ggtagccgcg      2340
     caagttaccg gcagcgcggt cgaagtggca agtctcggcg aagcgttcgg caccgccgtg      2400
     caagtgttcg gcgagtcgaa cgacaagctg gtcacgcacc tgcaacgtat tgaaaccgcg      2460
     ctcgacaaat cgctcgcacg cagcgacgaa cagcttgcct attacgtcgc gcaggcgcgg      2520
     gaagtgatcg atctgagcgt gatgtcgcag aagcagatcg tcgaagacct gcagcagctt      2580
     gccggccggc gcgcgtcggc gggagttgag gcggcatga                             2619
//

If you have problems or comments...

PBIL Back to PBIL home page