(data stored in ACNUC7421 zone)

EMBL: CP001053.PE485

CP001053.PE485       Location/Qualifiers
FT   CDS_pept        555772..556425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4486"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18860"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V8"
FT                   /protein_id="ACD18860.1"
FT                   /translation="MSDGGNSDPASGARATLDAWRERGDDRLDPVRFHFIDALERRAAG
FT                   HSGEARRILDERLSGLLDAYAGYIERAAAASANQTNAQAADEPTHATLKSLVDYIASQD
FT                   HVPAAIGLPRAASYPELPALDYFREVWSKVRAEKQMRQSLEQVPGNAGPLNSSSLVHRA
FT                   LSLMREVSPGYLKQFLSYVDALSWMEQINGGAAPAGKDAPRAGSTGKSARGKAR"
     gtgagtgacg gcggcaatag cgatccggca agcggagccc gagcgacgct agacgcatgg        60
     cgcgagcgcg gcgacgatcg gctcgatccc gttcgcttcc atttcatcga cgcgctcgaa       120
     cggcgcgcag ccggtcacag cggcgaagcg cggcggattc tggacgaaag gctatccggt       180
     ctgctggacg cttacgccgg gtatattgag cgcgccgcgg ccgcttcggc aaatcaaact       240
     aatgctcaag ccgccgacga gcccacacac gcaacgctga aaagcctggt cgactacatc       300
     gcgagtcagg atcatgtgcc cgcggcaatc ggtttgccgc gcgccgcttc atatcccgaa       360
     ctgcccgcgc tcgattactt cagggaagtc tggtcgaagg tccgcgcgga aaagcagatg       420
     cggcagtcgc tggaacaggt gccgggcaac gccggtccgc tcaattcgag cagcctcgtg       480
     catcgggcgc tctcgctcat gcgcgaggtg tcgccgggct acctcaagca gtttctgtcc       540
     tacgtcgatg ccttgtcgtg gatggagcag ataaacggcg gcgccgcgcc cgccggcaaa       600
     gatgcgcctc gcgccggcag caccggcaag agcgctcgcg gcaaagcacg ctag             654
//

If you have problems or comments...

PBIL Back to PBIL home page