(data stored in ACNUC7421 zone)

EMBL: CP001053.PE486

CP001053.PE486       Location/Qualifiers
FT   CDS_pept        complement(556479..556799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4487"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18861"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7V9"
FT                   /protein_id="ACD18861.1"
FT                   /translation="MKCPVCKTTDLLMTERRSIEVDYCPDCRGVWLDRGELDKLIAQDT
FT                   ANSDTPPAPRSSHDSHDSHDRHDRHRQRDHSYDSHRGYDEHRSGYRTQKKKRSLFDVFD
FT                   FD"
     atgaaatgcc cggtttgcaa gaccaccgac ctgctgatga ccgagcgccg ctcgatcgaa        60
     gtcgattact gtcccgactg ccggggcgtg tggctcgatc gcggcgaact cgacaagctg       120
     atcgcgcagg acacggcgaa ttcagacacg ccgcccgctc cgcgctcaag tcacgatagt       180
     cacgatagtc acgatcgcca cgatcgccat cggcagcggg atcattcgta cgacagccac       240
     cgcggttacg acgagcatcg atcgggttat cggacgcaga agaaaaagcg ctcgctcttc       300
     gacgtgttcg atttcgactg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page