(data stored in ACNUC7421 zone)

EMBL: CP001053.PE487

CP001053.PE487       Location/Qualifiers
FT   CDS_pept        complement(556893..557645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4488"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bxe:Bxe_B0807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4488"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18862"
FT                   /db_xref="GOA:B2T7W0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7W0"
FT                   /protein_id="ACD18862.1"
FT                   /translation="MDTLLTLVADPAAWAALLTLVVMEIVLGIDNLIFISILSNKLPEA
FT                   QRARTQRIGIMLALVMRLGLLGTVAWIAQLTAPAITLFAHAFSWRDLILLGGGLFLVWK
FT                   ATREIHHHVTHAEEERSKAGSTVQLTVAAAIGQILVLDMVFSVDSIITAVGMTEHMPIM
FT                   FVAVISAVLAMLFAARPLSRFIDRNPTIVTLALSFLLVIGMTLIAEGFGSHVPKAYIYV
FT                   AMAFSAFVEAMNMLVRRAKSKRALNSGQ"
     atggacactc tgctcacact cgttgccgac cccgccgcat gggccgcgct cctcacgctg        60
     gtcgtgatgg agatcgtgct cggcatcgac aacctgatct tcatctcgat cctcagcaac       120
     aagctgccgg aagcgcaacg cgcgcgcacg cagcgcatcg gcatcatgct cgcgctcgtg       180
     atgcggctcg gcctgctcgg caccgtcgcg tggatcgcgc aattgaccgc gcccgccatc       240
     acgctgttcg ctcacgcgtt ttcgtggcgc gatctgatcc tgctcggcgg cggcctgttc       300
     ctcgtctgga aggcgacgcg cgagattcac caccacgtga cgcatgccga agaagaacgc       360
     agcaaagcgg gcagcaccgt ccagttgacc gtggcggccg cgatcggcca gatcctggtg       420
     ctcgatatgg tgttctcggt cgacagcatc atcacggcgg tcggcatgac cgaacacatg       480
     ccgatcatgt tcgtcgcggt aatcagcgcg gttctcgcca tgctattcgc cgcacgcccg       540
     ctgtcacgct ttatcgatcg caatccgacc atcgtcacgc ttgcgctcag ttttctgctt       600
     gtgatcggta tgacgctgat tgcggaaggt ttcggttcac acgtgccgaa ggcctacatc       660
     tacgtggcga tggcgttctc cgcgttcgtg gaagcgatga acatgctggt gcgccgcgcg       720
     aaatcgaagc gcgcgctcaa cagcgggcaa taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page