(data stored in ACNUC7421 zone)

EMBL: CP001053.PE489

CP001053.PE489       Location/Qualifiers
FT   CDS_pept        complement(558621..559082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4490"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18864"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B2T7W2"
FT                   /protein_id="ACD18864.1"
FT                   /translation="MRTYPRNSPQAAARIVALALTSDGHVCSSEERVLQKLNIAGELGL
FT                   APAQFEQIVQTLCEDHSVAQLSFAPPVGRLDPAMLTTLIDEIDDPTLRRKVIRLCVAVT
FT                   VADDYLADGEIALLAAMLNAWGPDLTPAANRHGLPSRVLRGYQRAPATT"
     atgcgaacct acccgcgtaa cagcccgcaa gccgcagcac gcatcgtcgc gctagccctc        60
     acttcggacg gtcacgtgtg cagttcagaa gagcgtgtgc tgcagaaatt gaatatcgcc       120
     ggtgaactcg gtctcgcgcc cgcgcaattc gagcagatcg tgcagacgct gtgcgaagat       180
     cactcggtcg cgcaactgtc gttcgcgccg ccggtgggcc gtctcgaccc ggccatgctc       240
     acgaccttga tcgacgagat cgacgatcct acgttgcgcc gcaaggtgat tcgtctgtgt       300
     gtcgccgtga cggtcgcgga cgactatctg gcggacggcg aaatcgccct gctcgccgcc       360
     atgttgaatg cgtgggggcc cgacctgacg ccggccgcca accgtcacgg gctgccgtcg       420
     cgcgtattgc gcggttatca gcgcgcgccg gccaccacct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page