(data stored in ACNUC7421 zone)

EMBL: CP001053.PE49

CP001053.PE49        Location/Qualifiers
FT   CDS_pept        53349..54419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4038"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bpd:BURPS668_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18424"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA3"
FT                   /protein_id="ACD18424.1"
FT                   /translation="MRKNNGDIVTMPHAVTRVARALHAAVAASLTIFLLAQPAAPARAD
FT                   SPEKIVIMVGGITKLIYLPARLTEQLGYFKAEGLDVELQSQPAGVDAENELLAGGVQAV
FT                   VGFYDHAIDLQAKGKEIKAIVVFGQVPGEVEMVAARAAGSIRSMADVKGKTLGVTGLGS
FT                   STNFLTQYLASLKGVPRSQYTVLPVGADNSFIAAIRQGRIDAGMTTEPTVSQLLKSGDA
FT                   RVLVDMRNVEGTRAALGGTYPASSLYVQSAWLDTHPQEAAKLARALVKTLRYLNTHSAE
FT                   EIAAQMPKDYIGNDEALYVSALKASLPMFTADGKMPADGPETVLKVLAGFNPSVKGRHI
FT                   DLSRTFTNQFVNEVKP"
     atgcggaaaa acaacggaga catcgtcacc atgcctcatg ctgtgacgcg cgttgcgcgc        60
     gccctccatg ccgccgtcgc ggcgtcgctc acgatcttcc tgctcgcgca gccggctgcc       120
     cccgcgcggg ccgactcgcc cgaaaaaatc gtcatcatgg tgggcggtat taccaagctc       180
     atctatctgc ccgcacgcct gaccgaacag cttgggtact tcaaggcgga aggactcgac       240
     gtcgaactgc aatcgcagcc ggcgggcgtc gatgcggaaa acgaactgct cgcgggcggc       300
     gtgcaggccg tagtcggctt ctacgatcac gcgatcgatc tgcaagccaa gggtaaggaa       360
     atcaaggcga tcgtcgtgtt tggccaggtg cccggcgaag tggagatggt cgcggccagg       420
     gcggccggtt cgatcagaag catggccgac gtgaagggta aaacgctcgg cgtgacgggg       480
     ctcggttctt cgaccaactt tctcacgcag tacctcgcca gcctcaaagg cgtgccgcgt       540
     tcacagtaca cggtgctgcc ggtgggcgcg gacaacagct ttatcgcggc gatccggcaa       600
     gggcgtatcg atgcgggcat gactaccgag ccgactgtct cgcaactgct gaaatccggc       660
     gacgccaggg tactggtgga catgcgtaat gtcgaaggta cacgcgccgc gctcggtgga       720
     acttatccgg cctcaagcct gtatgtgcag agcgcgtggc tcgacacgca cccgcaagag       780
     gcggccaaac tggcgcgcgc attggtgaag acgttgcgat atctgaatac acatagcgcc       840
     gaagagatcg ccgcgcagat gccgaaagac tacatcggca atgacgaggc gctttatgtg       900
     agcgcgttga aggcctcgct gccgatgttc accgccgacg gcaagatgcc cgccgacggg       960
     ccggaaacgg tgctcaaggt gctggcgggt ttcaaccctt cggtgaaggg tcgtcatatc      1020
     gatctgtcga gaaccttcac caatcagttc gtcaatgaag tgaaaccgta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page