(data stored in ACNUC7421 zone)

EMBL: CP001053.PE491

CP001053.PE491       Location/Qualifiers
FT   CDS_pept        complement(559951..560271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4492"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18866"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX6"
FT                   /protein_id="ACD18866.1"
FT                   /translation="MKLTSLNRLMVRAAAGALVASAALLATASGAYAQTSAAPGTHQLT
FT                   RADVRHELEELEAAGYDPSRGDESDYPADIQEAERKVAAMHAAQQSALNNNQPAMQDAP
FT                   MH"
     atgaaactga cctctttgaa ccgtctcatg gtccgcgccg cagccggcgc actcgttgca        60
     agcgccgccc tcctggcaac ggcaagcggc gcctatgcgc aaacgtcggc cgcgcccggc       120
     acgcatcagc tcacgcgcgc cgatgtgcgc catgaactcg aggagttgga agccgccgga       180
     tacgatccgt ctcgcggcga cgaaagcgac tatcccgccg acattcagga agcggaaaga       240
     aaagttgccg ccatgcacgc agcccagcag agcgcgctaa acaacaacca gccagccatg       300
     caagacgcgc ccatgcattg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page