(data stored in ACNUC7421 zone)

EMBL: CP001053.PE492

CP001053.PE492       Location/Qualifiers
FT   CDS_pept        560457..560654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4493"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18867"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX7"
FT                   /protein_id="ACD18867.1"
FT                   /translation="MNIIDMARESGMAVVLDARIGREEYHSVCGSLSALEKFVDAIRQT
FT                   RVNHTTAIKPRQRPFTRGLK"
     atgaacatca tcgatatggc ccgtgaatcg ggaatggccg ttgtcctcga cgcccggatc        60
     ggccgggagg aataccacag cgtatgcggt tcgctgtcgg cgctagagaa atttgtcgac       120
     gctatccgcc agacacgggt gaatcacaca acggctatca agccgcggca acggcctttc       180
     acgcgaggcc tgaaatga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page