(data stored in ACNUC7421 zone)

EMBL: CP001053.PE495

CP001053.PE495       Location/Qualifiers
FT   CDS_pept        complement(563128..563865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4496"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0815 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18870"
FT                   /db_xref="GOA:B2TDY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY0"
FT                   /protein_id="ACD18870.1"
FT                   /translation="MDNPKRILIVEDDIDIANVLSLHLRDERYEVVHSADGNEGLRLLE
FT                   QGGWDALILDLMLPGVDGLEICRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLA
FT                   KPFSVLELVARVKALLRRVDALAKDSKIEAGSLRIAGLSIDPLTREAAVDGKPIELTPR
FT                   EFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPERIL
FT                   TVWGRGYKLAVPGEPAGAPKDVS"
     atggacaatc cgaagcgcat cctgatcgtc gaagacgaca tcgacatcgc caacgtgctg        60
     agcctgcatc tgcgcgacga gcgctatgaa gtcgtgcaca gcgccgacgg caatgaaggg       120
     ctgcgcctgc tggagcaagg cggctgggac gcgctgattc tcgatctgat gctgcccggc       180
     gtcgacggac tggaaatctg ccggcgcgcc cgcgcgatga cgcgctatac gccgatcatc       240
     atcaccagcg cgcggtcgag cgaagtgcac cggattctcg gcctcgaact cggcgcggac       300
     gactatctcg ccaaaccgtt ctccgtgctc gaactcgtgg cgcgtgtgaa agcgctgttg       360
     cgtcgcgtcg acgcgctggc gaaagactcg aaaatcgaag ccggcagtct gcgcatcgcc       420
     gggttgtcga tcgatccgct cacgcgcgag gccgccgtcg acggcaagcc gatcgaactc       480
     acaccgcgcg aattcgacct gctctattac ttcgcgcaac atcccggcaa ggtgttttcg       540
     cgcatggacc tgctcaatgc ggtgtggggc tatcagcacg aaggctacga gcacaccgtc       600
     aacactcata tcaaccggct gcgcgcgaag atcgaggccg atccggctca acccgagcgc       660
     atcctgaccg tttggggacg cggctacaag ctcgccgtcc ccggcgagcc agccggcgca       720
     ccgaaggacg tatcgtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page