(data stored in ACNUC7421 zone)

EMBL: CP001053.PE496

CP001053.PE496       Location/Qualifiers
FT   CDS_pept        563937..566012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4497"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   bxe:Bxe_B0816 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18871"
FT                   /db_xref="GOA:B2TDY5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY5"
FT                   /protein_id="ACD18871.1"
FT                   /translation="MAPLCKISGQRVITFNLTFREDFDTGGALGCGHFLQYQVLNELYA
FT                   GCRPSQRAHFNRPIRTFGTDMLLIVLAYLGGALTILSPCILPVLPFVFARADQPFVRSG
FT                   LPLLAGMALTFALVATLAAVGGGWVTQANQYGRWVAIALLAIFGLTLLFPRFADHLMRP
FT                   LVSAGNRLSNFAQTDGQQVRAGSSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGT
FT                   TLLLVAYAAGAATSLAVALLIGGKVFTAMKRSLGAGEWIRRGIGALMLCGVAAIALGFD
FT                   TGVLARVSTVATGGLEQKLVDKLSPNAAPGKAPVAGNAADASGGAMMSVNAASQSTAGA
FT                   DADSTAVNAAQGGAMMRTAVAAEAAPLPVEGVLPPLDGAVQWLNSPPLTTQDLRGKVVL
FT                   VDFWTYSCINCLRSLPYVKAWAQKYKDQGLVVIGVHAPEFAFERNIDNVKKATHDLGVD
FT                   YPVAIDNNYAIWRALNNQYWPAHYFVDAKGQIRYHHFGEGDYAGSEKVIQQLLTEAGHA
FT                   NASKVALGIANGGAQGVQAAADNADMQSPETYVGYQRAENFASPGGEVADKTHTYVAPS
FT                   QPGVNDWGLAGSWNVGAEHATLAASSGRIVYRFHARDLHLVLGPGKDGKPVRFRVSVDG
FT                   AAPGASHGTDVAADGSGTVTGQRLYQLVRQTGEVGDHTFSIEFLDPGVQAFAFTFG"
     atggcgccat tgtgcaaaat ttccgggcag cgagttatca catttaattt aacttttcgt        60
     gaggacttcg ataccggcgg cgctctagga tgtgggcact ttctgcagta tcaggttttg       120
     aatgaactgt acgccggctg ccgcccgagt cagcgtgccc actttaaccg acctatacga       180
     acgttcggaa ctgacatgtt actcatcgtt ctcgcctatc tcggcggcgc ccttacgatt       240
     ctcagcccgt gcatcctgcc ggtgctgccg ttcgtgttcg cgcgcgccga ccagcctttc       300
     gtgcgcagcg gcttgccttt gctggcgggc atggcgctga ccttcgccct cgtcgcgacg       360
     cttgccgcgg tgggcggcgg ctgggtcacg caggctaacc agtacggccg ctgggtggct       420
     atcgccctgc tggcgatctt cgggctgacc ctgctgttcc cgcgtttcgc cgatcatctg       480
     atgcggccgc ttgttagcgc cggcaatcgc ctgtcgaatt tcgcgcagac cgatggtcag       540
     caggtccgcg cgggttcgtc gtttctgctc ggcattgcta ccggcctgtt gtgggcgccg       600
     tgcgccggtc cgatactcgg tctcgtgctg acgggcgcgg cattgcgcgg tgcgagcgtc       660
     ggtacgacgt tgctgctggt ggcctacgcg gccggcgcgg cgacttcgct ggcggtggcg       720
     ctgctgatcg gcggcaaggt gttcacggcg atgaagcgct cgctgggcgc gggcgagtgg       780
     attcgccgcg gaatcggcgc attgatgttg tgcggcgtgg cggcgatcgc gctcggtttc       840
     gacactggcg tgcttgcccg cgtttcgacg gttgcgaccg gtggactcga acagaaactc       900
     gtcgataagc tgtcgccgaa cgcggcgccg ggtaaggcgc cggttgcggg caacgcggcc       960
     gatgcatccg gcggcgcaat gatgagcgtc aacgccgcgt cgcaatcgac ggcaggcgcc      1020
     gatgcggatt ccaccgcggt caatgcggcg cagggcggcg cgatgatgcg caccgccgtc      1080
     gccgccgaag cagcgccgct gcccgtggaa ggcgtgctgc ccccgttgga cggtgcggtt      1140
     caatggctga attcgccgcc actcaccacc caggacttgc gcggcaaagt cgtgctggtc      1200
     gacttctgga cttactcgtg catcaactgc ctgcgctcgc tgccgtatgt caaagcgtgg      1260
     gcgcagaagt acaaggatca gggactcgtc gtgatcggcg tgcatgcgcc ggagttcgcc      1320
     ttcgaacgca atatcgacaa cgtgaagaag gctacgcacg acctcggtgt cgactatccc      1380
     gtcgcgatcg acaacaacta tgcgatctgg cgcgcactga ataaccagta ctggcccgca      1440
     cactatttcg tcgatgcgaa agggcagatc cgctatcacc atttcggcga aggcgattat      1500
     gcggggtccg aaaaggtgat ccagcaactg ctgaccgaag cgggccacgc gaatgcatcg      1560
     aaggtcgcgc tcggaattgc aaacggcggc gcgcagggcg tgcaggccgc ggcggacaac      1620
     gccgatatgc aatcgccgga aacctacgtc ggttatcagc gggcggagaa cttcgcgtcg      1680
     ccgggcgggg aagtggcgga caagacgcac acgtacgtag cgccgtctca acccggcgtc      1740
     aacgactggg gtcttgccgg ttcatggaac gttggcgcgg agcacgcaac gctcgcggca      1800
     tcctctggac gcatcgtgta tcgctttcat gcacgcgacc tgcatctggt gctcggcccg      1860
     ggcaaggatg gcaagcctgt gcggtttcgc gtgagcgtcg acggcgccgc gcccggcgcg      1920
     tcgcacggca ccgacgtcgc cgccgatggc agcggcaccg taaccgggca acgtctctat      1980
     caactggtgc ggcaaacggg cgaagtcggg gatcacacgt tctcgatcga gtttctggac      2040
     ccgggtgtgc aggcatttgc tttcacgttc ggctga                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page