(data stored in ACNUC7421 zone)

EMBL: CP001053.PE499

CP001053.PE499       Location/Qualifiers
FT   CDS_pept        complement(570962..571450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18874"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY8"
FT                   /protein_id="ACD18874.1"
FT                   /translation="MHFVGNGSNGDQPLDFSNSVGLAGSWNGGGKTLPVSFNLEGMSFA
FT                   DANTGHRYGMITNETDDAFEARAQGFYFAALKGDPKQAARFVHFPLRVNWSATHHEMID
FT                   SASQLAANWNRIFTPKYLAALRDVVPHDMPVIKSQYAMLGAGLAFFTDKGVEVLNAQR"
     ttgcacttcg tcggcaatgg atcgaacggc gaccagccgc tcgatttttc caatagcgtg        60
     ggacttgccg gcagttggaa cggcggcggg aagactttgc cggtcagttt caatctcgaa       120
     ggcatgtcgt tcgcggacgc gaatacagga caccgctacg ggatgatcac caacgaaacg       180
     gatgacgcat tcgaagcacg cgctcaaggc ttctatttcg ccgcattgaa gggcgacccg       240
     aagcaggccg cgcgctttgt tcacttcccg ttgcgggtga actggagcgc gacgcatcac       300
     gaaatgatag attcggcgag tcagcttgcc gccaactgga atcgcatctt cacgccaaag       360
     tatcttgcgg cgctacgcga tgtcgttccg catgatatgc cggtgatcaa gagccaatac       420
     gcgatgctcg gagcagggct cgcgttcttt acggataagg gtgtcgaagt tttgaacgcg       480
     caacggtag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page