(data stored in ACNUC7421 zone)

EMBL: CP001053.PE50

CP001053.PE50        Location/Qualifiers
FT   CDS_pept        54486..55868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4039"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Two-component sensor
FT                   kinase domain protein; KEGG: bpd:BURPS668_0041 sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18425"
FT                   /db_xref="GOA:B2TEA4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA4"
FT                   /protein_id="ACD18425.1"
FT                   /translation="MFSGSLRGRLLWWLLLPLAAFVSISGVISYRNAQTTADLVQDNAL
FT                   LSSMRIIGEDIDWDNGNVSIQIPPAALELFESPEQDSVFYRVEASGHRLVEGSLELPLP
FT                   PQTGDKPTLYMTRLEDGRAVRAVAYVRQLYDTGRTEEVIVAVAKTEGSRDAMVWRLLRP
FT                   QLFGEVLTLVLAMVFVYLGLTFELRPLMKVKDDVADRNPSQLQPIRVARLHVELRPIVD
FT                   AINQCIARMGQQAATQRQFISDAAHQMRTPLTLLVAQIQFARQRENRDAPLAEALAGMH
FT                   KSSRKLTTLTDKLLLLAQAESAAPVSACERVDLSALIAGVLEELIAFAQSREIDLGAEL
FT                   EDGMVVTGDEALTAALVTNLVDNALRYTQAGGRVTVQTTRLNDIAIVRVIDNGPGIKPD
FT                   ARARVFERFYRASSHADGTGLGLPIVREIAHRQGGTVTLESGEDGIGFVATVGMRIWTA
FT                   AT"
     gtgttctcag gcagcttgcg cggacgcttg ctgtggtggc tactgctgcc actggcggcg        60
     ttcgtttcca tttccggcgt gatttcgtat cgcaacgcgc agaccacggc ggacctcgtg       120
     caggacaatg cgttgctctc gtcgatgcgc atcatcggcg aggatatcga ttgggataac       180
     ggcaatgtct cgatccagat tccgccggct gcgcttgaac tgttcgaatc gccggaacag       240
     gacagcgtgt tctatcgcgt tgaggcaagc ggccaccgcc ttgtggaggg cagtctggag       300
     ttgccattgc cgccgcaaac cggtgacaaa ccaacgctct acatgacccg tcttgaggac       360
     ggccgcgccg tgcgcgcagt cgcctacgtc cggcagcttt acgacaccgg acgcacggaa       420
     gaagtcatcg tcgcggttgc gaaaaccgag ggctcgcgag atgcgatggt gtggcgcctg       480
     ctgcgtccgc aactattcgg cgaggttctc acgctcgtgc tcgcgatggt gttcgtgtac       540
     ctcggattga cattcgagct gcgtcccctg atgaaagtga aagacgacgt cgccgatcgt       600
     aatccgtcgc agctacagcc aatacgtgtg gcgcgcttgc atgtcgaact gagaccgatc       660
     gtcgatgcaa tcaaccagtg catcgcgcgg atgggtcagc aggcagcgac tcagcggcaa       720
     ttcatttccg atgccgcgca tcagatgcgc acgccgctca cgctgctggt cgcgcaaatc       780
     cagtttgcga ggcaacggga aaaccgcgac gcaccgctcg ccgaagcgtt ggcaggcatg       840
     cacaagagca gccgcaagtt gaccaccttg accgacaaac ttctgctgct cgcgcaggcg       900
     gagtccgccg cgcccgtcag tgcctgcgaa cgcgtcgatc tcagtgcatt gatcgcgggt       960
     gtgctggagg agttgatcgc attcgcgcag tctcgtgaaa tcgatctggg tgccgaactg      1020
     gaagacggaa tggtcgtgac cggcgacgag gcgttgaccg cggcgctcgt caccaatctt      1080
     gtcgacaacg cgctgcgtta tacccaggct ggcggtcgcg tcaccgtgca gaccacccgt      1140
     cttaatgaca tcgccatcgt gcgtgtgatc gacaatggac cgggtatcaa gcccgatgcg      1200
     cgggcgcgag tgttcgaacg cttctatcgc gcgtcgagtc atgcagacgg cactggcctc      1260
     ggcctgccga ttgtgcgcga gattgctcat cggcagggcg gtaccgtcac gctcgaatcc      1320
     ggcgaggatg gtattgggtt cgtcgccacg gtgggaatgc gaatctggac cgccgcgaca      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page