(data stored in ACNUC7421 zone)

EMBL: CP001053.PE501

CP001053.PE501       Location/Qualifiers
FT   CDS_pept        571955..572629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4503"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bxe:Bxe_B0822 HAD-superfamily hydrolase, subfamily
FT                   IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4503"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18876"
FT                   /db_xref="GOA:B2TDZ0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ0"
FT                   /protein_id="ACD18876.1"
FT                   /translation="MRIQTSFLFDLDGTLVDSVYQHVLAWKEALDSEGIPLSVWRIHRK
FT                   IGMSGGLFTNQLLRETHGEINADRVERLRQAHAAAYQRLRAQVCPLPGARALLDALTQA
FT                   GTPWAVATSGRMETAALNLEALGVDPAKAVVVTRDDVKYAKPDPDLFIAAAGRLGVPVE
FT                   HTVVVGDSIWDMLAARRCRALGVGLLSGGYGTEELERAGALRVYDDPADLLDHLDEVAS
FT                   RP"
     atgcgaatcc agacctcttt cctcttcgat ctcgacggga cgctggtcga cagcgtctac        60
     cagcacgtgc tggcctggaa agaagcgctc gacagcgaag gcattccctt gtcggtctgg       120
     cgaattcacc gcaagatcgg catgagcggc gggctcttca ccaatcagct tttgcgggaa       180
     acgcacggcg agatcaacgc cgaccgggtc gagcgtctcc gtcaagctca cgccgcagcc       240
     tatcagcggt tgcgcgcaca ggtgtgtccg ctgccgggcg cgcgtgcgct gctcgacgcg       300
     ctgacgcaag ccggaacgcc ttgggccgtg gcgacgagcg gccgcatgga gacggcggcg       360
     ctcaatctgg aggccctcgg ggtcgatccg gcgaaggccg tggtcgtcac gcgcgacgac       420
     gtcaaatatg caaagccgga tccggatctg ttcatcgccg ccgccgggcg gctcggcgta       480
     ccggtcgaac acacggtggt ggtcggcgac agcatctggg acatgctcgc ggcgcggcgc       540
     tgccgggcgc tgggcgtggg tttgctgtcg ggcggatacg gcacggagga actcgagcgc       600
     gccggcgcgc tgcgggtcta cgacgatccg gcggatctgc tggatcatct ggacgaggtg       660
     gcgtcgcgcc cgtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page