(data stored in ACNUC7421 zone)

EMBL: CP001053.PE502

CP001053.PE502       Location/Qualifiers
FT   CDS_pept        572982..573944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4504"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_B0823 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4504"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18877"
FT                   /db_xref="GOA:B2TDX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX4"
FT                   /protein_id="ACD18877.1"
FT                   /translation="MNNFIRPPVFHPSTVVFVDDNDSYLDALRRFFPDSATNLFFTRPQ
FT                   TALAFIRQHARKNSLEFAPASACVSETGFERYMETAAERDILARGSRFAEVAAVVVDFD
FT                   MPGMNGVEFLSSISNLRCAKVLLTGVADETVAVKAFNAGIVDLYLRKTDTDSANRLAHF
FT                   LKDAKARHCSEGGWLALGENGLTYCDPRTRKVIDEVVAANGIVEYYWRPEQDAILMFDR
FT                   AGNPSVFVAWAENDWISQGEIVADEDGPADLLKQMAVREVMPIFWPNLAYRSGMTVRTL
FT                   TPRTIPGWDDVFYCWTPIDKADVGMDLLTFAQWRKDRTR"
     atgaacaatt ttattcgacc acctgttttc catccgtcga cggttgtctt cgtggatgac        60
     aacgacagct atctcgacgc gctgcggcga ttctttccgg acagcgccac caatctgttt       120
     tttacgcggc cgcaaaccgc gctggccttc atccgtcagc acgcccgcaa gaattcgctc       180
     gagttcgcgc cggcctcggc ctgtgtgagc gagacgggtt ttgagcgcta catggaaacc       240
     gcggcggaac gcgatattct ggcccgcggc tcccgtttcg cggaagtcgc ggcggtggtc       300
     gtggatttcg acatgccggg catgaacggc gtggaattcc tctcgtccat ctccaacctg       360
     cgctgcgcaa aagtgctgct gaccggcgtc gcggacgaaa ccgtcgcggt caaagccttc       420
     aatgcgggaa tcgtcgattt atacctgaga aagaccgata ccgactccgc caaccggctg       480
     gcccatttcc tgaaggatgc caaggcgagg cactgttcgg aaggcggctg gctcgcgttg       540
     ggcgagaacg gcctgacgta ttgcgacccg cgaacgcgta aagtgatcga cgaggtggtg       600
     gccgcgaacg gtatcgtcga gtattactgg cgcccggaac aggacgccat tctgatgttc       660
     gatcgtgccg gcaacccgag cgttttcgtc gcgtgggccg agaacgactg gatctcgcag       720
     ggcgaaatcg tcgcggacga ggacggcccg gccgaccttc tcaagcaaat ggcggtgcgc       780
     gaggtgatgc cgatcttctg gccgaacctg gcctatcgct ccggcatgac cgtcaggacg       840
     ctgaccccgc gcactattcc gggctgggac gacgtgttct attgctggac cccgatcgac       900
     aaggccgacg taggcatgga cctgttgacg ttcgcgcaat ggcggaagga ccggacgcgc       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page