(data stored in ACNUC7421 zone)

EMBL: CP001053.PE503

CP001053.PE503       Location/Qualifiers
FT   CDS_pept        573969..575411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4505"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: reu:Reut_B3506 ATP-binding region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4505"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18878"
FT                   /db_xref="GOA:B2TDY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY1"
FT                   /protein_id="ACD18878.1"
FT                   /translation="MYAIPTACVSAMFVVFGLYVLITQGATRLFTPFILMCVSTFAWQG
FT                   AWTLLFQTDNPHTADLLVRGGYLFILFLPTTFYHFVTEVAAQRREQPILLASYGLCFVL
FT                   AILLPGNEVVAGYQHFFFGYYPVAGPLHPLHVVQTVLLAGRSAQLLLAARQKAEGDARR
FT                   RLDLCLASLCLYSFAAMDYAVNYGFGFYPPGVLFIGLSLGLLAITIVRYHLIHPYAVAA
FT                   TIAHEISTPLATIGMHADEIASVWGHVFKGYRTAVTHGLYEDHDEVGQSERIGQLATAI
FT                   RREVSGTSAMVEMALASFTLDRLDRGDFSRHSVHQCVMSTLERYPFSGDERERVTVMPI
FT                   DLAMSFSGSDTVVVFVLFNLLKNALHAIRVGGDGAITISAVQDQDFCVLQFRDTGPGIA
FT                   PDVLPYIFDAFFTTKRHGSGAGMGLAFCRRATELLGGSIECSSIRGIHTTFTVRLPAPD
FT                   TPADRALRKTPAQHSPRWSQGQ"
     atgtacgcca ttccgaccgc ctgcgtgtcc gcgatgttcg tggtgttcgg cctatacgta        60
     ctgattacgc aaggcgcgac gcgtttattc acgccgttca tcctgatgtg cgtctcgacc       120
     ttcgcgtggc aaggcgcatg gacactgctg ttccagacgg acaacccgca caccgcggac       180
     ctgctggtca ggggcggcta tctattcatt ctttttctgc cgacaacgtt ctaccacttc       240
     gtgacggaag tggcggcgca gcgccgcgag cagccgatat tgctggcgtc gtacggtctg       300
     tgtttcgtcc tcgcgatact gctgcccggt aacgaagtgg tggcgggcta tcagcatttc       360
     ttcttcggct actatccggt cgccgggccg ctgcatccct tgcacgtggt gcagaccgtg       420
     ctgctggccg gccgcagcgc gcagcttctg ctcgccgcgc gtcagaaggc agagggcgac       480
     gcgcggcggc gcctcgatct gtgtctggcg agcctgtgtc tgtactcgtt tgccgcgatg       540
     gactacgcgg tcaactacgg cttcgggttc tatccgccgg gcgtcctgtt catcggtctg       600
     agcctcgggc tgctggcgat caccatcgtg cgctatcacc tgattcaccc gtatgccgtg       660
     gcggcgacca ttgcgcacga aatctcgacg ccgcttgcca ccatcggcat gcacgccgac       720
     gaaatcgcca gcgtgtgggg gcatgtgttc aaaggatacc gaacagccgt cacgcacggg       780
     ctgtatgagg atcacgacga ggttggacag tccgaacgca tcggccagct ggcgacggcg       840
     atccggcgcg aagtctccgg caccagcgca atggtcgaaa tggcgctcgc gtctttcacg       900
     ctcgatcgtc tggatcgcgg cgacttcagc cggcattcgg tgcatcagtg cgtgatgtcc       960
     acgctcgaac ggtatccgtt cagcggcgac gagcgtgagc gtgtcacggt gatgcccatc      1020
     gacctcgcca tgtctttttc gggctcggat acggtcgtgg ttttcgtgct gttcaatctg      1080
     ctgaaaaacg cgttgcatgc cattcgcgtg ggcggcgacg gggcgattac gatcagtgcc      1140
     gttcaggatc aggacttctg cgtgctgcaa ttccgcgaca cggggcccgg catcgcgccc      1200
     gacgtcctgc cctatatctt cgacgctttc ttcacgacca agcggcacgg cagcggcgcg      1260
     ggcatgggac tcgcgttctg ccgtcgcgcg acggagctgc tgggcgggag tatcgagtgc      1320
     agttcgatac gcggcatcca caccaccttc accgtgcggt tgccggcgcc ggacacgccc      1380
     gccgatcgcg cactgcgcaa gacgccggcg cagcattcgc ctcgctggag tcagggccaa      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page