(data stored in ACNUC7421 zone)

EMBL: CP001053.PE505

CP001053.PE505       Location/Qualifiers
FT   CDS_pept        complement(576445..576954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4507"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18880"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY3"
FT                   /protein_id="ACD18880.1"
FT                   /translation="MPQPAALPCYRDTVRAEWVDYNGHLRDAFYMLIFSFATDALIDLI
FT                   GLPDVVRKERQRSIYTLEAHINYLHEIKEGAQVRVDMRVLGHDAKRLHLYLEMFAGDGG
FT                   KPLAAGEQMLLHVDTGGPRAAAFDPDVAAHVKALADAHAALPPAAFAGRVIGLPAKTKP
FT                   SGSGHA"
     atgccgcaac ccgctgccct gccttgctat cgcgacacgg tgcgcgccga atgggtcgat        60
     tacaacggcc atctgcgcga cgcgttctac atgctgattt tcagcttcgc gaccgatgcg       120
     ctgatcgacc tgatcggttt accggacgtc gtgcgcaagg agcgccagcg ctcgatctac       180
     acgctcgaag cgcatatcaa ctatctgcac gagatcaagg aaggcgcgca ggtgcgcgtc       240
     gacatgcgcg tgctcggtca cgatgcgaag cggctgcatc tgtacctcga gatgttcgcc       300
     ggcgatggcg gcaaaccgct agcagcaggc gagcagatgt tgctgcacgt ggataccggc       360
     ggcccacgtg cagccgcgtt cgatccggac gtcgcggcgc atgtgaaggc attggccgac       420
     gcgcatgccg cactgccgcc cgcggcgttt gccgggcgag tgattggctt gcccgcgaaa       480
     acgaagccga gtgggagtgg acatgcttga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page